KEGG   Ornithorhynchus anatinus (platypus): 100073357Help
Entry
100073357         CDS       T01045                                 

Gene name
CLK4
Definition
CDC-like kinase 4
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100073357 (CLK4)
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100073357 (CLK4)
Spliceosome [BR:oaa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100073357 (CLK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 480 aa AA seqDB search
MRHSKRAHCPDWDGRESWEHESYGCSYKRKKRFHSSTQENRHYKPHLQFKESECHYMEAR
AINERDYYERRYVDEYRNDFCEGYEPRHYPRDYESSYYDCSKSSGRSRRSSQRRRRMRHC
SSHQSHSRSHRRKRSRSIEDDEEGHLICQSGDVLRARYEIVATLGEGAFGKVVECIDHDM
GGMHVAVKIVKNVGRYREAARSEIQVLEHLNTTDPNSIFRCVQMLEWFDHHGHVCIVFEL
LGLSTYDFIKENSFLPFHLDHIRQMAYQICQSINFLHHNRLTHTDLKPENILFVKSDYVV
KYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDVW
SIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPTHMIQKTRKRKYFHHNQLDWDEHS
SAGRYVRRRCKPLKEFMLCHDAEHENLFDLVRRMLEYDPNKRITLDEALQHPFFDLLKKK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcggcattcaaaacgagctcactgtccggattgggatggtagagaaagttgggaacat
gaaagctatggttgcagctataagcgcaagaagagattccacagtagtacccaagagaac
aggcactacaaaccccatctacagtttaaagaatcagaatgccattatatggaagccaga
gccataaatgagagagattattatgagcgaagatatgttgatgaatacagaaatgacttc
tgtgaaggatatgagcctagacattatcccagagactatgaaagcagttattatgactgc
agtaaatcttcaggccgaagcaggagaagtagtcaaagacggagacgtatgaggcattgt
tcaagccatcagtcgcattcgaggagtcaccgaaggaaaagatccaggagtatagaggat
gatgaggagggtcacctgatctgtcaaagtggagacgtgctaagagcaagatatgaaatt
gtggctactttgggtgaaggggcttttggcaaagtggtagagtgcatcgaccatgatatg
gggggcatgcatgtagctgtgaaaattgtaaaaaatgtgggtagataccgtgaagctgct
cgttcagaaattcaagtattggaacacttaaacactactgatccaaatagcatattccgc
tgtgtccaaatgctggagtggtttgatcatcacggtcacgtgtgcatcgtgtttgaatta
ctgggtctcagtacttatgattttattaaagaaaatagttttttaccatttcacctcgat
catatccggcagatggcttatcagatttgccagtcaataaattttttgcatcacaacaga
ttgacccatacagatctgaagccagaaaatattttgtttgtgaagtctgactatgttgtg
aaatacaactccaaaatgaaacgggatgaacgcacactaaaaaacacagacattaaagtt
gtggactttggaagtgcaacgtatgatgatgaacatcacagtactttggtttctactcga
cactacagagctccagaggtcattttagccctaggatggtctcaaccctgtgatgtgtgg
agcataggctgcattcttattgaatattatctcggcttcacagtatttcagacccacgat
agtaaagaacacctcgcaatgatggagcgaatcttgggacctataccaactcacatgata
cagaaaacgagaaaacgcaaatattttcaccacaaccaattggattgggatgaacatagt
tctgccggtcggtatgttaggagacgatgcaaaccattaaaggaattcatgctttgtcac
gacgcagaacatgaaaatttgtttgacctggttcgaagaatgttagagtacgatccgaac
aaaagaatcaccttggatgaagcactgcagcatcctttttttgacttactaaaaaagaaa
taa

DBGET integrated database retrieval system