KEGG   Ornithorhynchus anatinus (platypus): 100073414Help
Entry
100073414         CDS       T01045                                 

Gene name
ANGPT2
Definition
angiopoietin 2
Orthology
K05466  
angiopoietin 2
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Ras signaling pathway
Rap1 signaling pathway
HIF-1 signaling pathway
PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100073414 (ANGPT2)
   04015 Rap1 signaling pathway
    100073414 (ANGPT2)
   04066 HIF-1 signaling pathway
    100073414 (ANGPT2)
   04151 PI3K-Akt signaling pathway
    100073414 (ANGPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X1
AA seq 495 aa AA seqDB search
MWLIVFFTLSSDLVLASGYNSFRKSMDTIGKKQYQVQHGSCSYTFLLPETDNCRSSSSAY
FSNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEMQQNAVQNH
TAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSE
ITKLQEKNSFLEKKVLDMEDKHTVQLQSIKDEKDQLQVLVSRQNSIIEELEKQLVTATVN
NSVLQKQQHDLMETVHNLLTMISSPNSKNSFVAKEEQILFRDCAEAYKSGLTSNGIYTLT
FPNSTEETKTYCDMESGGGGWTVIQRRIDGSVDFHRTWKEYKMGFGDPAGEYWLGNELVS
QLTNRQRYVLKIQLKDWEGNEAYSLYEHFYLSSEELNYGIHLKGLTGTAGKISSISQPGN
DFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSG
YSLKATTMMIRPADF
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcattgttttttttactttgagctctgatctcgtcttagcttcaggctacaac
tcctttcggaaaagcatggacaccatcgggaagaagcagtaccaggttcagcacgggtcg
tgcagctacaccttcctcttaccggagacggacaactgccgttcttcttcgagcgcctat
ttctccaacgccgttcagagggatgccccgctagactacgacgattcggtgcaaagactc
caggttctggagaacatcatggaaaacaacacgcagtggctcatgaagcttgagaattat
atccaggacaacatgaagaaagaaatggtagagatgcaacagaacgcagtacagaaccac
actgcagtgatgattgaaataggcaccaatctcctaaatcaaacggcagaacagacccgc
aaattaacagatgttgaagcgcaagtattaaaccagacaaccagacttgaacttcagctt
ctagagcattcactttctacaaacaaattagaaaagcaaattttggatcagacaagtgaa
ataactaaattgcaagagaagaacagcttcctagaaaagaaagtcctcgacatggaagat
aaacacacagttcaactccagtcaataaaagatgaaaaagatcaacttcaagtattagta
tccagacaaaattccataatcgaggaattggagaaacaactagtgacagcgacagtaaac
aattccgttcttcagaaacagcaacacgatctcatggaaactgtgcacaacttgctgacg
atgatttcgtcaccgaactctaagaactcctttgtggctaaagaagaacagatcctgttc
cgagactgtgccgaggcgtacaaatcgggactcacgagcaacggcatctacaccttaaca
ttccctaactccacagaagagacaaagacatattgtgacatggaatcaggtggcggtgga
tggacagttattcagcggcgcatagacggcagcgtggactttcatcggacatggaaagaa
tacaaaatgggatttggcgatccggcgggggagtactggctaggaaacgaacttgtttcc
cagctgactaatcggcaacgttacgtccttaaaattcagctcaaagactgggaaggaaac
gaggcatattcattatatgaacacttttatctctcgagtgaagaactcaactacgggatc
cacctcaaaggacttacggggacagcaggcaaaataagcagcataagccaaccaggaaat
gattttagcacaaaggatgccgacaatgacaaatgcatttgcaaatgttcacagatgctc
acaggaggctggtggtttgatgcctgcggcccttccaacctgaacgggatgtactaccca
cagaggcagaacacaaataaattcaatgggattaagtggtactactggaaaggctcgggc
tactctctcaaagccacaactatgatgatccggccggcggatttctaa

DBGET integrated database retrieval system