KEGG   Ornithorhynchus anatinus (platypus): 100073431Help
Entry
100073431         CDS       T01045                                 

Gene name
PRKG1
Definition
protein kinase, cGMP-dependent, type I
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
cGMP-PKG signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100073431 (PRKG1)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100073431 (PRKG1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100073431 (PRKG1)
  Digestive system
   04970 Salivary secretion
    100073431 (PRKG1)
  Nervous system
   04730 Long-term depression
    100073431 (PRKG1)
  Sensory system
   04740 Olfactory transduction
    100073431 (PRKG1)
  Environmental adaptation
   04713 Circadian entrainment
    100073431 (PRKG1)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100073431 (PRKG1)
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100073431 (PRKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 570 aa AA seqDB search
MYVHPDNHQGPVNSDFRNLQSGCEDSDNVYMQIFMTLQAGQKDGKVEVTKEGVKLCTMGP
GKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTF
QSLPEEILSKLADVLEEIRFSSSREGECSSLTGRVNMNTTTDYSDTDSDSYGGDSGDTCG
DSDDEDSSGEAEKISEEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEA
KAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTR
QQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTT
RFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGT
PEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPK
KIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVA
SPTDTSNFDSFPEDNDEPPPDDNSGWDIDF
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtccatcctgacaaccaccaggggccagtgaactcagattttcgaaacttgcaa
tcaggatgtgaggattcagataatgtctatatgcaaatttttatgacactgcaggctgga
caaaaagatggaaaggttgaagtcacgaaagagggtgtgaagctgtgtaccatgggacca
ggaaaagtctttggagaattggctattctttataactgcactcggacagcgaccgtcaaa
actcttgtaaatgtgaaactttgggccatcgatcgacaatgttttcaaacgataatgatg
aggacaggactcatcaagcacaccgagtatatggaatttttaaaaagtgttccaacattc
cagagccttcctgaagagattctcagtaagctcgctgacgtccttgaggagataagattt
agtagcagcagagaaggagagtgcagttctttgacaggaagggtgaacatgaatactact
acggattattcagacacagatagtgattcttatggtggagatagtggagatacttgtgga
gatagtgatgatgaagattccagtggtgaagctgagaaaatatcagaggaagatgtgaga
acggccaatgtaattgctgcagaagcggtaacctgccttgtgattgacagagactctttc
aagcacttaattggagggttggacgatgtttctaataaggcttatgaggatgcagaagct
aaagcaaaatatgaagctgaagctgccttcttcgccaacctgaaactttctgatttcaac
atcattgacacccttggagttggaggtttcggacgagttgaactggtccagctgaaaagt
gaagaatccaaaacatttgcaatgaagattctcaagaaacgccacatagtggatacaaga
cagcaagagcacatccgttctgaaaagcagataatgcaaggggctcactcagacttcatt
gtgagactttaccgaaccttcaaggacagcaaatatttgtatatgttgatggaagcatgc
ctgggtggagagctttggactattctcagggatagaggttcatttgaagattctacaact
agattttatacagcgtgtgtggtagaagcctttgcctatctgcattccaaaggaatcatc
tatagggacctcaagccagaaaacctgattctagatcatcgaggttatgccaaactggtt
gattttggctttgcaaagaaaataggatttggaaagaaaacatggactttttgtgggact
cctgaatatgtagccccggagatcatcctgaataaaggtcatgatatttcagcagactac
tggtcactgggaatcttaatgtatgaactcctgactggcagcccacctttctcaggccca
gatcccatgaagacctataacattatactgagaggaattgacatgatagaatttccaaag
aagattgcaaaaaatgctgctaatttaatcaaaaaactatgcagggataatccatcagaa
agattaggtaacttgaaaaacggcgtgaaagacatccaaaagcacaaatggtttgaaggc
ttcaactgggaaggcttgagaaaaggcaccctgacacctccaataatacccagtgttgca
tctcctacagacacaagcaattttgacagtttccctgaggacaacgacgaaccaccacct
gacgacaactcgggctgggatatagacttttaa

DBGET integrated database retrieval system