KEGG   Ornithorhynchus anatinus (platypus): 100073485Help
Entry
100073485         CDS       T01045                                 

Gene name
EZH2
Definition
enhancer of zeste homolog 2 (Drosophila)
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100073485 (EZH2)
Enzymes [BR:oaa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100073485 (EZH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 760 aa AA seqDB search
MMCPHISGESRIIMGQSGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFNSNRQ
KILERTEILNQEWKQRRIQPVHIMTSVSSLRGTRECSVTSDLDFPKQVIPLKTLNAVASV
PIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFIN
DEIFVELVNALGQYSDEDDDDDEGDDPDERDEKQKDQEDKRDDKESHPPRKFPSDKIFEA
ISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFC
RRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPHCYQHLEGAKEFAAALTAERIKTP
PKRPGGRRRGRLPNNTSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSS
SSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQV
YEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHP
RQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCL
TCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEII
SQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDH
RIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgcccacacatctctggagaaagcaggataatcatgggccagtctggaaagaaa
tctgagaagggaccggtttgttggcggaagcgtgtaaaatcagagtacatgcgactgaga
caactcaagaggtttagacgagcagatgaagtaaagagtatgtttaattctaatcgtcag
aagatactggaaagaacagaaatcttaaatcaagaatggaaacagcgaaggatacagcct
gtacacatcatgacttctgtgagctcattgcgagggaccagggagtgttctgtgaccagt
gacctggattttccaaagcaagttatacctttaaagaccttaaatgctgttgcttcagtg
cccataatgtattcttggtctcctttacagcagaattttatggtggaagatgagactgtt
ttacataacattccttatatgggggatgaggtccttgatcaagatggaaccttcattgaa
gaactaatcaaaaattatgatggaaaagtgcatggagatagagaatgtgggtttatcaat
gacgagatttttgtggagctggtaaatgctcttggccaatacagcgatgaggatgacgat
gatgatgaaggagatgatcctgatgagcgagatgaaaaacaaaaagatcaggaggacaaa
agagatgataaagagagccacccaccccggaagtttccttctgataagatttttgaagcc
atttcctcaatgtttcctgacaagggcacagcagaagaattaaaggaaaagtacaaagaa
ctaacagagcagcaactccccggagcacttccccctgagtgtacaccaaacatagatgga
ccaaatgctaaatctgtacagagggagcaaagcctgcattcgtttcacacccttttctgc
aggcgctgctttaaatatgactgcttcttacatccattccatgccacgcccaacacatat
aagcggaagaacacagaaacagcactagataacaagccttgtggaccacactgttaccag
catctggaaggggcaaaagagtttgcagctgccctgactgccgaacggataaagaccccg
ccaaaacgccccgggggccgccgaagaggaaggcttcccaataacaccagcagacccagc
accccaacaattaacgtgctggagtcaaaggacaccgacagcgacagggaagctggcact
gaaaccggcggggagaataatgataaagaggaggaggagaagaaagacgaaacctctagt
tcctctgaggcaaactccaggtgtcaaacgccaataaagatgaagccaaatattgagcct
cctgagaatgtggaatggagtggggctgaagcctcaatgttcagagttctcattggcact
tattacgacaatttctgtgcaattgccaggctaataggaaccaaaacttgtaggcaggtc
tatgaatttagagtaaaggaatccagtattatcgccccagctcctgctgaagatgttgac
acccctccaagaaagaagaagaggaaacacaggctgtgggctgcacattgccgaaagata
caactgaaaaaggatggctcctccaatcatgtttacaactatcaaccatgtgatcacccg
cgccagccttgtgacagttcatgcccatgtgtaattgctcaaaacttttgtgagaagttt
tgtcagtgtagctcagaatgccaaaaccgatttcctgggtgccgttgtaaagcacagtgt
aacactaagcagtgcccgtgctaccttgctgttcgtgagtgcgatccagacctctgtcta
acctgtggggccgctgatcactgggacagcaaaaacgtgtcctgcaagaactgtagcatt
cagaggggctccaaaaagcatttgctgctggcaccttctgatgtggcaggctgggggatt
ttcatcaaagatcccgtacagaagaatgaattcatctctgagtactgtggtgagattatt
tctcaggatgaggcagacagaagagggaaggtctatgataagtacatgtgcagctttcta
ttcaacttgaataatgattttgtggtggatgcaacccggaagggtaacaaaatccgtttt
gcaaaccattcggtaaatcccaactgctatgcaaaagtcatgatggttaatggtgatcac
agaatagggatttttgcaaagagagccatccagactggtgaagagctgttttttgactac
agatacagccaggctgatgcccttaagtatgtgggcatcgaaagagagatggaaatccct
tga

DBGET integrated database retrieval system