KEGG   Ornithorhynchus anatinus (platypus): 100073550Help
Entry
100073550         CDS       T01045                                 

Gene name
BAP1
Definition
(RefSeq) BRCA1 associated protein 1
  KO
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100073550 (BAP1)
Peptidases [BR:oaa01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100073550 (BAP1)
Ubiquitin system [BR:oaa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    100073550 (BAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 666 aa AA seqDB search
MNKGWLELESDPGLFTLLVEDFGVRGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRR
KVSTLVDETSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSNVDLGPTLSRMKDFTK
GFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKGRL
FELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRMK
YESKLHVLKMNRQTVLEALQQLIRVTQPELIQTQKSQEAQAPEDPKPGSSKAPAVLDANR
THLASEGSHADGAEDTARPCQQAPTNSPPNKSKLAVKPPVSGHNGASANPSPIVQRLPAF
LDNHNYAKSPMQEEEDLAAGVGRSRVPVRQHQQYSDDEDDYEDEEEEDARNTNSALRYLS
HSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLR
VDCMRYNRAVRDLGPVISTGLLHLAEDGVLCPLIVTEGEKSSPTSSRQSELAQVVAKVEE
KPLPEASDSKGTSRNAEQPGGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKID
DQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRP
YKAKRQ
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagggtggctggagctggagagcgacccaggtctcttcaccctcttggtggag
gatttcggtgttagaggggtgcaggttgaggagatctatgatcttcagagcaaatgccag
ggccccgtgtatgggttcatcttcctcttcaaatggatcgaggaacgccggtctcgccgc
aaagtctccaccctggtggacgagacttcagtgatcgatgatgacattgtgaataacatg
ttctttgcccatcagctgatccccaactcttgtgctactcatgccttgctgagcgtcctg
ctaaattgcagcaatgtggacctggggccaacgctgagccgcatgaaagacttcaccaag
ggattcagccctgagagcaaaggatatgcaattggaaatgctcctgaactggccaaagca
cataacagccatgcaaggcctgaaccacgtcacctgcctgagaaacagaatggaatcagc
gctgtacgaaccatggaggccttccacttcgtcagctatgtccccatcaaggggcggctt
tttgaactggatggactgaaggtgtaccccattgaccatgggccttggggtgaagatgaa
gagtggacagacaaagccaggagagtcatcatggaacgaattggcctagccacagcagga
gagccgtatcacgacatccgctttaacttgatggcggtggtgcctgaccgcaggatgaag
tatgagtccaagctgcatgtcctgaagatgaatagacagacagtgctggaggccctgcaa
cagttaatccgtgtaacccaaccagagctaattcagacccaaaagtcccaagaggctcag
gcccccgaagatccaaaaccaggcagcagcaaggccccggcagtgcttgatgcgaacagg
actcacctggcttctgagggctctcacgctgatggggccgaagatacggctcggccgtgc
cagcaggcccccaccaatagccctcccaacaaatccaaactggctgtgaagcctcccgtg
agcggccacaatggagcttcggccaaccccagccccattgttcagcggctgccggctttc
ctggataaccacaactatgccaagtcccccatgcaggaagaagaggacctggccgcaggc
gtgggccgcagtcgcgtcccggtccgtcagcaccagcagtactctgacgacgaagatgat
tacgaggacgaggaggaagaggatgcgcgcaacaccaactctgccctcaggtacctgtcg
cactcccagccctcacccacacccagcaatgaaagcacagacactgcctccgagatcggg
agtgccttcaactcccctctgcggtcccccatccgctcggccaatcccacccgcccatcc
agccccgtcacctcccacatctccaaggtgctctttggggaggatgacagcttgctgcgt
gtggactgcatgcgctataaccgggccgtgcgggacctgggacctgtcatcagtactggc
ctgctgcaccttgctgaggatggggtgctttgccccctcatcgtcacagaaggggaaaaa
agctccccgacgtccagcagacaaagcgagcttgctcaagtggttgccaaggtggaggag
aaaccgttacccgaggcgagtgacagtaaaggaacgagcaggaacgcggagcagccgggt
ggagagaagtattcccccaaagagctgttggctttgctgaagtgtgtggaggcagagatt
gcaaactacgaagcctgcctcaaggaagaagtggagaagagaaaaaagtttaagattgat
gaccagagaagaacccataactacgacgagttcatctgcacctttatctctatgttggcg
caggaaggaatgctggccaaccttgtagagcagaatatctctgtgcgtcggcggcagggt
gtcagcatcggccgcctccataagcagcggaagcccgaccgcaggaaacgctcccgccca
tataaagccaagcgccagtaa

DBGET integrated database retrieval system