KEGG   Ornithorhynchus anatinus (platypus): 100073578Help
Entry
100073578         CDS       T01045                                 

Gene name
USP8
Definition
ubiquitin specific peptidase 8
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100073578 (USP8)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100073578 (USP8)
Peptidases [BR:oaa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100073578 (USP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 1124 aa AA seqDB search
MPAVASGPKDLYLCSSLKDLNKKTEVKPEKISTKSYVQSALKIFKTAEESRLDRDEEKAY
VLYMKYVTVYNLIKIRPDFKQQQDYFHSILGPANIKKAIEEAERLSESLKLRYEEAEVRK
KLEEKDRQAEQQLQQKKQETGRDGGKASTKSTLENVLDPKGKSQKINGEKKERSEKVEQD
SISQGAVTAEKLFTMMMDKSVSLIIMDARSLKDFQTSSIVNSLCVPEEAIKPGTTTHRIE
ENLPEVSKDTWKNRGSVDFVVLLDWFSSTKDLLLGTTLRSLKDALFKWESQTVLRNEPLV
LEGGYENWLLCYPQFTTNAKVTPPPRGKSEEVSISLDFTYPSLEEPAPPPPAAQVRPSPV
AGNENTDGRSNREERTGPLNPPTPGGPVAARGSPVVQATSTVKNVPQIDRSKKPTTKPPD
AHKVRAESAEPDPKSLQNGKMVPDRSKKPAFDPTAVLTEEEKSRIHAETAFLIEKSKREK
ERRERQQEEQKEKLRREEQERKVQENREGEEREPREERRQVGAAADGREGGQAKREEEET
PERRPREAAGAKRQNQSDHESAEAEKSDLDRGSTEDRETGPQTSELPKKPLGGPAQASGM
EEPSSSKHVRVKEQPESDVPKAGTSKDTSEDPERNKSQREPLTRARSEEMGRIVPGLPAG
WAKFLDPTTGTFRYYHSPTNSVHIYPPEMAPPSTPPATPPTHKAKPKVSTERDREPSKLK
RSYSSPDITQAIQEEEKKKPIVTPAVNRENKPLCHPKAEISRLSASQIRNLNPVFGGAGP
ALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNFYQEDINRSNLLGHKGEVAEEFGIIM
KALWTGQYRYISPKDFKITIGKINDQFSGYSQQDSQELLLFLMDGLHEDLNKADNRKRHK
EENNDHLDDCRAAELAWHKHKQLNESIIVALFQGQFKSTVQCLTCHKRSRTFEAFMYLSL
PLASTSKCSLQDCLRLFSKEEKLTDNNRFYCSHCKTRRDSLKKIEIWKLPPVLLVHLKRF
SYEGRWKQKLQTSVDFPLESLDLSQYVIGSKSSLKRYNLFSVSNHYGGLDGGHYTAYCKN
AARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLELRAADVAT
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtggcctccggacctaaagacctctacctctgttcttcactgaaagatctt
aacaagaagacagaagttaaaccagagaaaataagtaccaaatcttacgtgcagagtgcc
ctgaaaattttcaagacagcagaagaaagcagattggatcgtgatgaagagaaggcctat
gtcttatatatgaaatacgtgactgtgtataatcttataaaaataagacccgatttcaaa
cagcagcaggactactttcattcaatactcggacctgcaaacatcaaaaaagctatcgaa
gaagccgaaagactctctgaaagcctaaaactcagatatgaggaagccgaagttcggaag
aagctcgaagaaaaagacagacaggcagaacagcagctgcagcagaaaaagcaggaaaca
ggaagagatggtggaaaggcgtcaactaagagtactttggagaacgtattggaccctaaa
ggcaaaagtcagaagatcaatggggaaaagaaggaaagaagtgaaaaagttgagcaagat
tctatatcccagggagcagtcacagcggagaaactgttcaccatgatgatggataagagc
gtcagtttgatcatcatggatgcccgcagtttgaaagatttccaaacttcctctattgtc
aattctctctgtgtccctgaggaagccatcaaacctggaaccaccacgcatcggatcgaa
gaaaacctccccgaggtttctaaagacacctggaagaatcggggctctgttgactttgtg
gtactgctggactggtttagttcgacaaaagatttacttcttggaacaactctacgcagt
ctgaaagatgccctttttaagtgggaaagtcagaccgtcctgcggaacgagcccttagtt
ttggaaggaggctatgaaaattggctcctttgttaccctcagttcacaacgaatgctaaa
gtcaccccacctcctcggggaaagagcgaagaggtttctatctcactggattttacctac
ccgtctctcgaagagccggcccctcctcccccagccgcccaggtacggccatctcctgtc
gcgggaaatgaaaacacagacgggcgaagcaaccgggaagagagaacggggccgcttaac
cccccaactccaggagggccagttgctgctcgcggctcccctgtggttcaggcaacgagc
actgtgaagaacgttcctcagatcgatcgttctaaaaagcccacaaccaaaccgcccgat
gctcataaagtcagagctgagagcgccgagcccgacccgaagtcccttcagaacgggaag
atggttcccgaccgatccaaaaagcccgcatttgacccgaccgccgtcctgacggaggaa
gaaaagagccgcattcacgccgagaccgccttcctgattgagaagagcaaacgagaaaaa
gagcgacgggaaaggcagcaagaggagcagaaagagaagctcaggcgggaagagcaggag
cggaaagtccaagagaaccgggaaggggaagaaagagaaccccgggaggaacgacggcaa
gtcggggcagcggccgacgggcgagagggcgggcaggcgaagagagaggaggaggaaact
ccggagagaagacccagagaagccgcaggagcaaaaaggcaaaaccagagcgaccatgag
agcgcagaggctgaaaaatccgacctcgacagaggttccacggaagatcgagagacaggc
cctcaaacttcagaactgccgaaaaagcccctaggaggtccggcccaagcttctgggatg
gaagagccgagctcgagtaagcatgttagagttaaagaacagccagaaagtgacgtgccc
aaagcaggaacctctaaagatacttccgaagaccccgaaagaaataaatctcaacgagag
ccattgacaagagcccgaagtgaagaaatgggaaggatagtacctggattgcctgcaggc
tgggccaagtttctcgatcccactacagggacctttcgctattaccactcaccgaccaac
tcggttcacatatacccccccgaaatggctcctccctccacgcccccggccacgccccca
acccacaaggccaagcccaaggtatccacggagcgggacagagagccgtccaagttgaag
cgctcctactcctcaccggatataacccaagccatccaggaggaggagaagaagaaacca
atcgtaacgcccgccgtcaaccgggaaaacaagccactctgccacccgaaggctgaaatc
tccaggctgtccgcctctcagattcggaacctcaacccggtgttcggcggggcgggccca
gcgctcactggacttcgcaacctggggaacacctgctacatgaactccatcctgcagtgc
ctgtgcaatgctccacacctggccgattatttcaacagaaacttctatcaggaagacatt
aacaggtcaaacctgctggggcataaaggcgaagtggccgaggagtttggtatcatcatg
aaagccctgtggaccgggcagtataggtatatcagcccaaaggactttaagatcaccatt
gggaagatcaatgaccagttttcgggctacagccagcaagactcccaagagttgctcctg
ttcctgatggatggacttcacgaagacctaaataaagctgacaaccggaagaggcataag
gaagagaacaacgaccacctggatgactgcagagcagcggagttggcctggcacaagcac
aagcagctgaacgaatccatcatcgtggcgctcttccaaggccagttcaagtcgaccgtc
cagtgcctcacgtgtcacaagaggtcgcggacgttcgaggccttcatgtatttgtcttta
ccgctcgcgtccaccagcaagtgctccctgcaggattgcctcaggttattttccaaagag
gagaaactcaccgataacaacagattctactgcagtcactgtaagacgcgaagagactcc
ctgaaaaaaatagaaatctggaagctgcctcctgtgctcttagtacacttgaaacgtttt
tcgtacgaagggcggtggaaacagaaactacagacgtcagttgatttcccgttggagagc
ctggacctgtcccagtacgtcatcggctccaagagcagtttgaagagatacaacctgttt
tctgtctccaaccactacgggggcctggacggaggacactacaccgcctactgtaaaaac
gccgcccgccaacggtggttcaagttcgacgaccacgaggtgtccgacatctccgtctcc
tccgtgaaatcgtcggccgcctacatcctgttctacacctccttggagctccgagcggcc
gacgtagccacgtaa

DBGET integrated database retrieval system