KEGG   Ornithorhynchus anatinus (platypus): 100073704Help
Entry
100073704         CDS       T01045                                 

Definition
group XV phospholipase A2-like
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:oaa00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:oaa04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X1
AA seq 301 aa AA seqDB search
MAKQTHQGGLEANDSDEKSTHGKTLPGDLGNQLEAKLDKPTVVHYLCSKKTDSYFTLWLN
LELLLPIIIDCWIDNIRLIYNKTTRATQFPDGVDVKVPGFGQTFSLEFLDPSKRSVDENG
EYFEALRKMIEMMYEQYGGPVVLIAHSMGNMYTLYFLNQQPQGWKDKYIHSFVALGAPWG
GVAKTLRVLASDFTDGWYMRQDTEPLVYQMTPPGVRLHCLYGTGVQTPDSFYYESFPDRD
PKIFYSDGDGTVNLQSSSYCRKWVGQQKQEVTLLELQGNEHIEMLSNITTISYLKKVLFG
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacagactcaccaaggtggattggaagcaaatgactcagatgaaaagtctact
cacggcaaaaccttgcccggggacttggggaaccagctggaagccaagttggacaaaccc
acagtggtacactacctgtgctccaagaagacagacagttacttcaccctttggttgaat
ctggagttacttctccctatcattattgattgctggattgataatatcaggctgatctac
aacaaaaccaccagggctacccagtttccagatggtgtagatgttaaagttccaggcttc
ggacaaacattttctttggaatttcttgaccccagtaaaagaagtgttgatgagaacggc
gagtattttgaagcactccggaagatgatcgaaatgatgtacgagcagtatgggggacct
gtggttttgattgcccacagtatgggtaacatgtacaccctgtacttcctcaaccagcaa
cctcagggctggaaagacaagtacatccattcctttgtggcattaggtgccccttggggg
ggcgtggcaaagaccctccgagttctggcttcagactttacggatggctggtacatgcga
caagacacagaacccttggtctatcagatgacccctcctggggtgcggcttcactgcctg
tatggcaccggggtccagaccccggactcattctactatgagagcttccctgatcgagac
cccaagatcttctacagcgatggcgacggaactgtgaacctgcagagttcgtcgtactgc
cgcaaatgggtaggccagcagaagcaggaggtgacgctgttagagctgcaaggtaacgag
catattgaaatgctctcgaacatcaccaccatttcctatttgaaaaaggttctctttggt
tcgtga

DBGET integrated database retrieval system