KEGG   Ornithorhynchus anatinus (platypus): 100073704Help
Entry
100073704         CDS       T01045                                 

Gene name
PLA2G15
Definition
(RefSeq) phospholipase A2 group XV
  KO
K06129  lysophospholipase III [EC:3.1.1.5]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00564  Glycerophospholipid metabolism
oaa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100073704 (PLA2G15)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100073704 (PLA2G15)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100073704 (PLA2G15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LCAT DUF915 Hydrolase_4 Abhydrolase_6 DUF900 Abhydrolase_1 PGAP1 AAA_25
Motif
Other DBs
NCBI-GeneID: 100073704
NCBI-ProteinID: XP_007653670
Position
X1
AA seq 320 aa AA seqDB search
SPFVAGRAPLREPALACCLLLILPGPGVPAPPAHRPPVVLVPGDLGNQLEAKLDKPTVVH
YLCSKKTDSYFTLWLNLELLLPIIIDCWIDNIRLIYNKTTRATQFPDGVDVKVPGFGQTF
SLEFLDPSKRSVGMSHYENGEYFEALRKMIEMMYEQYGGPVVLIAHSMGNMYTLYFLNQQ
PQGWKDKYIHSFVALGAPWGGVAKTLRVLASVTDGWYMRQDTEPLVYQMTPPGVRLHCLY
GTGVQTPDSFYYESFPDRDPKIFYSDGDGTVNLQSSSYCRKWVGQQKQEVTLLELQGNEH
IEMLSNITTISYLKKVLFGS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
tcgccattcgtggccggccgcgctcccctccgggagcccgccctcgcctgctgcctccta
ctgatactgcccggccccggcgtccccgcgccccccgcccaccgccctcccgtcgtgcta
gtgcccggggacttggggaaccagctggaagccaagttggacaaacccacagtggtacac
tacctgtgctccaagaagacagacagttacttcaccctttggttgaatctggagttactt
ctccctatcattattgattgctggattgataatatcaggctgatctacaacaaaaccacc
agggctacccagtttccagatggtgtagatgttaaagttccaggcttcggacaaacattt
tctttggaatttcttgaccccagtaaaagaagtgttggtatgtcgcattatgagaacggc
gagtattttgaagcactccggaagatgatcgaaatgatgtacgagcagtatgggggacct
gtggttttgattgcccacagtatgggtaacatgtacaccctgtacttcctcaaccagcaa
cctcagggctggaaagacaagtacatccattcctttgtggcattaggtgccccttggggg
ggcgtggcaaagaccctccgagttctggcttcagttacggatggctggtacatgcgacaa
gacacagaacccttggtctatcagatgacccctcctggggtgcggcttcactgcctgtat
ggcaccggggtccagaccccggactcattctactatgagagcttccctgatcgagacccc
aagatcttctacagcgatggcgacggaactgtgaacctgcagagttcgtcgtactgccgc
aaatgggtaggccagcagaagcaggaggtgacgctgttagagctgcaaggtaacgagcat
attgaaatgctctcgaacatcaccaccatttcctatttgaaaaaggttctctttggttcg
tga

DBGET integrated database retrieval system