KEGG   Ornithorhynchus anatinus (platypus): 100073732Help
Entry
100073732         CDS       T01045                                 

Gene name
ARG1
Definition
arginase 1
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100073732 (ARG1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100073732 (ARG1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    100073732 (ARG1)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100073732 (ARG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 324 aa AA seqDB search
MSGKAKSVGIIGAPFSKGQPRGGVEEGPLYLRNAGLIEKLEAQGCDVKDYGNLAIVDAPN
DSPFQNVKNPRSVGQTNQGLASMVADVKKSGRVSVVLGGDHSLGIGSISGHARVHPDLCV
IWVDAHTDINTPETSTSGNLHGQPVAFLMKELKSKIPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHCIVKNLGIKCYSMSEVDKLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPFH
TPATGTPVPGGLSYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVSKTVNTAVAVT
LSCFGVAREGNHSSADCPHPQKTN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcaaggcaaaatcagtggggatcatcggcgcgcctttctccaagggacagcca
cgaggaggagtggaagaagggccgctttatctgagaaatgctggtctgatagagaaactc
gaagcacaaggttgcgatgtgaaggactatgggaatctggccattgttgatgctcccaat
gacagtccatttcaaaatgtgaagaacccgcgctcagtgggacaaaccaaccagggactg
gccagcatggtggcggacgtgaagaagagtggcagggtcagcgtggttctcggcggggat
cacagcctggggattgggagcatctctggccacgcaagggttcaccctgatctctgtgtc
atttgggtcgacgcccacactgacatcaacactccggagacatccactagtggtaacctg
cacgggcagccagtggctttcctcatgaaggagctgaagtccaagatccccgatgttcct
ggattctcttgggtgacaccgtgcatatcagccaaggacattgtgtatattggattgaga
gatgtggatcctggtgaacactgtattgtgaagaatctgggaattaaatgctattcaatg
agtgaggtggataagcttggaattggcaaggttatggaagaaacacttagctatttgctg
ggaagaaagaagagaccaattcacctgagcttcgatgttgatgggctggacccttttcac
acaccggctaccggcacacctgttcctggaggtctgtcttacagagaaggcctctacatc
acagaagaaatttataaaacaggactcctgtcgggactagacataatggaggtcaatcca
tctcttggaaagacacccgaagaagtgagcaagacagtcaacactgctgtcgcagtaacc
ctgtcttgctttggagtggctcgggagggtaatcatagctcggctgactgccctcacccc
caaaaaacaaattga

DBGET integrated database retrieval system