KEGG   Ornithorhynchus anatinus (platypus): 100073732Help
Entry
100073732         CDS       T01045                                 

Gene name
ARG1
Definition
(RefSeq) arginase 1
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100073732 (ARG1)
  Amino acid metabolism
   00220 Arginine biosynthesis
    100073732 (ARG1)
   00330 Arginine and proline metabolism
    100073732 (ARG1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    100073732 (ARG1)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100073732 (ARG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 324 aa AA seqDB search
MSGKAKSVGIIGAPFSKGQPRGGVEEGPLYLRNAGLIEKLEAQGCDVKDYGNLAIVDAPN
DSPFQNVKNPRSVGQTNQGLASMVADVKKSGRVSVVLGGDHSLGIGSISGHARVHPDLCV
IWVDAHTDINTPETSTSGNLHGQPVAFLMKELKSKIPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHCIVKNLGIKCYSMSEVDKLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPFH
TPATGTPVPGGLSYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVSKTVNTAVAVT
LSCFGVAREGNHSSADCPHPQKTN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcaaggcaaaatcagtggggatcatcggcgcgcctttctccaagggacagcca
cgaggaggagtggaagaagggccgctttatctgagaaatgctggtctgatagagaaactc
gaagcacaaggttgcgatgtgaaggactatgggaatctggccattgttgatgctcccaat
gacagtccatttcaaaatgtgaagaacccgcgctcagtgggacaaaccaaccagggactg
gccagcatggtggcggacgtgaagaagagtggcagggtcagcgtggttctcggcggggat
cacagcctggggattgggagcatctctggccacgcaagggttcaccctgatctctgtgtc
atttgggtcgacgcccacactgacatcaacactccggagacatccactagtggtaacctg
cacgggcagccagtggctttcctcatgaaggagctgaagtccaagatccccgatgttcct
ggattctcttgggtgacaccgtgcatatcagccaaggacattgtgtatattggattgaga
gatgtggatcctggtgaacactgtattgtgaagaatctgggaattaaatgctattcaatg
agtgaggtggataagcttggaattggcaaggttatggaagaaacacttagctatttgctg
ggaagaaagaagagaccaattcacctgagcttcgatgttgatgggctggacccttttcac
acaccggctaccggcacacctgttcctggaggtctgtcttacagagaaggcctctacatc
acagaagaaatttataaaacaggactcctgtcgggactagacataatggaggtcaatcca
tctcttggaaagacacccgaagaagtgagcaagacagtcaacactgctgtcgcagtaacc
ctgtcttgctttggagtggctcgggagggtaatcatagctcggctgactgccctcacccc
caaaaaacaaattga

DBGET integrated database retrieval system