KEGG   Ornithorhynchus anatinus (platypus): 100073878Help
Entry
100073878         CDS       T01045                                 

Definition
phosphoglycerate mutase 1-like
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:oaa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:oaa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:oaa00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:oaa00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 303 aa AA seqDB search
MEKTMVDQLGEEWPRLRDHSSGPVSGHVAAMSPRVRRGDGSGPSTPRLTAQNHELCGPRK
GGLPSAAPLYLGLRDGKSPKDPGGPPHLRVAVVFPDAGYEFDICFTSVQKRAIRTLWTVL
DAIDQMWLPVVRTWRLNERHYGGLTGLNKAETATKHGEAQVKIWRRSYDIPPPPMEADHP
FYSNISKDRRYADLTEDQLPSSESLKDTIARSLPFWNEEIVPQIKEGKRVLVAAHGNSLR
GIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGK
AKK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaactatggtcgatcaacttggagaagagtggcctaggcttagggatcactcg
agcggccctgtgtccggccacgtggcagccatgagccccagggtccgccgaggagatgga
agcggccccagcacccccagactcactgcccagaatcacgagctttgtggcccgaggaag
ggaggtctccccagtgccgcgccactgtaccttggcttacgtgacggtaaaagccccaag
gacccgggcgggccgcctcacctgcgtgttgccgtggtttttccagatgccggctatgag
ttcgatatctgcttcacctcggtgcagaagagggccatccgcaccctctggacggtgctc
gatgccatcgaccagatgtggctccccgtggtgaggacctggcgcctcaacgagcgccac
tacgggggcctgacaggcctcaacaaggcggagacggccaccaaacatggcgaggcccag
gtgaaaatctggcgccgctcctacgacatcccgccgcctcccatggaggccgaccacccc
ttctacagtaacatcagtaaggatcgtcgctacgcagaccttaccgaggaccagctgccc
tccagcgagagcctgaaggatacgatcgctcggtctctgcccttctggaatgaggagatc
gtcccgcagattaaggagggcaagcgagtgctggtcgctgcccatggcaacagcctgcgg
gggattgtcaagcatctggaaggcctgtcggaggaagccatcatggagctgaatctgccc
accggcatccccatcgtctacgagctggacaagaacctgaagcccatcaagcccatgcag
ttcctgggggatgaagagactgtgcgcaaagccatggaggccgtggctgcccagggcaag
gccaagaagtga

DBGET integrated database retrieval system