KEGG   Ornithorhynchus anatinus (platypus): 100073915Help
Entry
100073915         CDS       T01045                                 

Gene name
KCNMB3
Definition
potassium large conductance calcium-activated channel, subfamily M beta member 3
Orthology
K04939  
potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Insulin secretion
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100073915 (KCNMB3)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    100073915 (KCNMB3)
  Circulatory system
   04270 Vascular smooth muscle contraction
    100073915 (KCNMB3)
Ion channels [BR:oaa04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   100073915 (KCNMB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 321 aa AA seqDB search
MKGSRIAMSGMGSTSVTPRLGIYPGQSFWIPSNVISAGETTRELEGRICASKSLESSGRE
RHLNYSDGDKTPEKNKKLPSNAGEERAVFLGFAMMGFSVLMFFLLGITILQPFMLSTQRE
ESNCTAIRVHIVDVWLDCSSICAADCWQRGKYPCLQVLVNLSHSAQKVLLYYNEEAVQLN
PKCFYTPKCHRARNDLLDSALDLKNFFDQKNGTPFSCFYRSDSKSEDVILTQKYDKMAIF
HCLFWPSLTLLGGALIVGMVKLTQHLSFLRDKYPVAIKEANCLTSQAELRRHKMSRKTER
KDKGILRWELNSQISHHSLLL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggtcccgtatagccatgtcagggatgggctctacttcagtcacccccagatta
ggtatctatccaggtcaatccttctggatacccagcaacgtgataagtgctggggagact
acaagagaattggaaggcaggatctgtgcctccaagagtttagagtctagtgggagagag
agacacttaaattacagtgatggggacaaaacaccagaaaaaaacaagaagttgccatca
aatgccggagaagagagagctgtgttccttggatttgcaatgatgggcttctcagtcctt
atgtttttcttgcttggaatcaccatcctacagccttttatgctcagcactcagagagaa
gagtcaaactgcaccgccatccgagtgcacatcgtggatgtttggctggactgctcttcc
atctgtgctgccgattgctggcagcgggggaagtacccgtgtcttcaggtgcttgtcaac
ctctcccattctgcccagaaagttcttctgtattacaatgaagaagctgttcaactcaac
cccaagtgtttttacaccccgaagtgccatcgggctaggaatgatttactcgacagtgct
ctggacctaaagaacttctttgatcaaaaaaatggcactcctttctcctgcttctacagg
tctgacagcaagtcggaagatgtcattttgacccaaaagtatgacaaaatggccatcttc
cattgtttattctggccctcattaactttgctaggtggggccttgattgttggcatggtg
aaattaacccagcatctatcgttcctccgtgacaaatatccagtggcaataaaggaggct
aactgcctcacatcacaagcagaactgcgtagacataaaatgtctaggaagacggaaaga
aaggataagggaattttacgatgggagctcaattcgcaaatcagccaccacagtctgctt
ctctga

DBGET integrated database retrieval system