KEGG   Ornithorhynchus anatinus (platypus): 100073932Help
Entry
100073932         CDS       T01045                                 

Gene name
RAE1
Definition
ribonucleic acid export 1
Orthology
K14298  
mRNA export factor
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
RNA transport
Influenza A
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100073932 (RAE1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100073932 (RAE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 368 aa AA seqDB search
MSLFGSASGFGTGGTSMFGSTTADNHNPMKDIEVTSPPDDSIGCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDNGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQA
IQIAQHDAPVKTVHWIKAPNYSCVMTGSWDKTLKFWDTRSPSPMMTLQLPERCYCADVVY
PMAAVATAERGLIVYQLENQPSEFRRIDSPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTTAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgtttggatcagcctcaggctttggaactggtggtaccagcatgtttggaagc
acaactgcagataatcacaaccctatgaaggatatcgaagttacatctcctcctgatgat
agtattggttgtctatcttttagcccaccaacattgccagggaactttcttattgccggt
tcctgggccaatgacgtgcggtgttgggaagtacaggataatggacaaactatcccaaag
gctcagcagatgcacactggcccggtgcttgatgtctgttggagtgatgatggaagcaaa
gtattcacagcatcatgcgataaaactgccaaaatgtgggacctcaacagtaaccaggct
attcagattgcacagcacgatgctcctgtgaaaactgtgcattggatcaaagcaccaaac
tacagttgcgtgatgacaggtagctgggacaagactttaaagttttgggatacacgatca
ccgagccccatgatgacattgcagctgcctgaaagatgttactgtgctgatgtggtctat
cccatggccgctgtggctactgcagagagagggctgattgtttatcagttagagaaccag
ccttctgaatttagaagaatagactctccacttaagcaccagcaccgttgtgttgccatt
tttaaagacaaacagaataaacctaccggctttgctctgggaagcattgaaggaagagtt
gctattcattatattaacccacccaatcctgccaaagataatttcacctttaagtgtcat
cgatccaatggaacgaataccacggcacctcaggatatctatgcagtaaatgggatagca
tttcaccctgtccacggcaccctggcaaccgtggggtctgatggcagattcagcttttgg
gacaaagatgcaaggacgaagctgaaaacatcagaacagctggatcaaccaatatctgct
tgttgcttcaatcataatggaaacatatttgcatatgcttctagttatgactggtcaaag
ggacatgaattttacaatccccaaaagaaaaattacatttttctgcgaaatgctgcagaa
gagttaaagcccagaaataagaagtag

DBGET integrated database retrieval system