KEGG   Ornithorhynchus anatinus (platypus): 100074057Help
Entry
100074057         CDS       T01045                                 

Definition
protein disulfide-isomerase A6-like
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:oaa04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 491 aa AA seqDB search
MGDADVFEGRGEKSIRELMQICRTGIPDKAFEMFKESIFGYCSHLSENPLKVFALPKGDF
MPGALRKKLRCQHPFPVLLRGWGVLEVVKPQEMPKYPSSALLGERCGHCQRLTPEWKKAA
TALKGVVKVGAVDADKHQSLGGQYGVKGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALS
ALRPLVKDRLSGRSGGYSSGKQGGSGGSSKKDVIELTDDNFDKNVLESDDVWLVEFYAPW
CGHCKNLEPEWAAAATEVKDQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGEEP
RDYDGGRTRSDIVSRALDLFSDNAPPPELLEIVDEAVAKKTCEDHQLCVIAVLPHILDTG
ASGRNSYLEVMLKLADKYKKKMWGWLWTEAGAQFELENALGIGGFGYPAMAAVNARKMKF
ALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPKINTVEPWDGKDGELPLEDDIDLSD
VELDDLGKDEL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgcggacgtgtttgaaggcagaggagaaaaatccatcagagagctgatgcag
atttgcagaacaggaatacctgataaagcatttgaaatgttcaaggagtctatatttggg
tattgcagtcacctttcagaaaatcctcttaaagtttttgctttgcctaagggtgacttt
atgcccggagctttaagaaagaagctgagatgccagcatcctttccctgttctcctgcgt
ggatggggagttctggaagtagtaaagccacaggaaatgcctaaatatccctcctcggct
ttattgggtgagaggtgtggtcattgccagaggttaacaccagagtggaaaaaagcagca
acagcattaaaaggggtagtgaaagtgggtgctgtggatgcagataaacatcagtcccta
ggtggtcagtacggtgttaaaggatttcccactatcaagatctttggcgccaataaaaac
aaacccgaagattaccagggtggcagaacaggagaagctatcgtcgatgcggccctgagc
gccctccggcctctggttaaggatcgccttagcggaaggagtggtggatatagttctggg
aagcagggtggcagtggaggctcaagtaagaaggatgtgattgagctgaccgatgacaac
ttcgacaaaaacgtcctggagagtgacgacgtttggctggtcgagttttatgctccttgg
tgtggacactgcaaaaacttagagccagaatgggcagctgctgccactgaagtcaaggat
cagaccaaagggaaagtgaaattagctgccgtggatgctacagtcaaccaagtcctggct
agccgatatgggatccgagggttccccacaatcaagatttttcagaaaggagaagagccc
cgggattatgatggtggaagaacaagatctgatatcgtttcacgggctctggatttgttt
tcagataatgctccaccccctgagctgcttgagattgttgacgaagcggtagccaagaag
acttgtgaggaccaccagctctgtgtcattgccgtattacctcatattcttgataccggt
gcttccggaagaaattcctatttggaagttatgttaaagttggcagacaaatacaaaaag
aaaatgtgggggtggctgtggacagaagctggagcccaatttgagctagaaaatgcattg
ggaatcggaggatttgggtaccctgcaatggcagctgttaatgcaaggaagatgaaattc
gccctcctgaaaggatcttttagtgaacaaggcatcaatgagtttctcagggagctctct
tttggacgtggttccacagctccggtaggcggtggggctttccctaaaataaacactgtg
gagccatgggatggcaaagatggtgagcttccacttgaagatgatatcgacctcagtgac
gtggaactcgacgacttgggaaaagacgaattgtga

DBGET integrated database retrieval system