KEGG   Ornithorhynchus anatinus (platypus): 100074142Help
Entry
100074142         CDS       T01045                                 

Gene name
PPIP5K2
Definition
diphosphoinositol pentakisphosphate kinase 2
Orthology
K13024  
inositol hexakisphosphate/diphosphoinositol-pentakisphosphate kinase [EC:2.7.4.21 2.7.4.24]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 1376 aa AA seqDB search
MSLPQKEDDPPRFFVGAEEGEDEPLDSTKPEEFEHFYDPAEEEEDEEYDSDDPPRFFVGA
EEGEDEPLDSTKPEEFEHFYDPAEEEEDEEYDSPPERQIVVGICSMAKKSKSKPMKEILE
RVSMFKYIMVVIFEEDVILNEPVENWPLCDCLVSFHSKGFPLDKAVAYAKLRNPFVINDL
NMQYRIQDRREVYSILQAEGILLPRYAILNRDPNNPKECNLVEGEDHVEVNGAIFQKPFV
EKPVSAEDHNVYIYYPTSAGGGSQRLFRKIGSRSSVYSPESNVRKTGSYIYEEFMPTDGT
DVKVYTVGPDYAHAEARKSPALDGKVERDSEGKEVRYPVILNAREKLIAWKVCLAFKQTV
CGFDLLRANGQSYVCDVNGFSFVKNSMKYYDDCAKILGNIIMRELAPQFQIPWSIPLEAE
DIPIVPTTSGTMMELRCVIAVIRHGDRTPKQKMKMEVRHQKFFDLFEKCEGYKSGKLKLK
KPKQLQEVLDIARQLLLELGQNNDSEIEESKSKLEQLKTVLEMYGHFSGINRKVQLTYLP
HGCPKTSSEEEDTRREEPSLLLVLKWGGELTPAGRVQAEELGRAFRCMYPGGQGDYAGFP
GCGLLRLHSTYRHDLKIYASDEGRVQMTAAAFAKGLLALEGELTPILVQMVKSANMNGLL
DSDSDSLSSCQHRVKARLHEILQRDREFTTEDYEKLTPSGSISLIKSMHLIKNPVKTCDK
VYSLIQSLTSQIRQRMEDPKYSDIQLYHSETLELMLRRWSKLEKDFKTKNGRYDISKIPD
IYDCIKYDVQHNGSLKLENTMELYRLSKALADIVIPQEYGISKVEKLEIAKGYCTPLVRK
IRSDLQRTQDDDTVNKLHPLYSRGVMSPERHVRTRLYFTSESHVHSLLSILRYGALCDES
KDDQWKRAMDYLNVVNELNYMTQIVIMLYEDPNKDLSSEERFHVELHFSPGAKGCEEDKN
LPSGYGYRPASRESDGSKKSPHKNDSDEEPHASKRDEPDRAVLMFKPMVSDPIHIHRKSP
LPRSRKIGTNEEESPLSVSNPEGTGTWLHYTSGVGTGRRRRRSGEQITSSPVSPKSLAFT
SSIFGSWQQVVSESSSYLRTPRTLVEQKQNALGTHCAGLFSTSVLGGSSSAPNLQDYART
HRKKLTSSGCMDGFELYSMVPSICPLETLHNALSLKQVDDFLASVAMPSTDSRLETPSAL
SSPSCSSPHSRRKMSLNTYTPAKILPTPLAPVQHGKAAGKSALCEILILLWLADNPEPVG
PLANLQLVPHLLSRVHMSEERTERLKTKRLNRRSKILQRKPQPCTRLYSSKHCSELEHVF
VNMQGWILAVEIVNSSHLAHGGADPFPSKELNPKSGNGSVSRRELRDGLQLLSKLW
NT seq 4131 nt NT seq  +upstreamnt  +downstreamnt
atgtcccttccacaaaaagaggatgacccccccagattctttgtcggggctgaagaagga
gaggatgaacctttggattccaccaagcctgaagaatttgagcacttctatgaccccgcc
gaagaggaggaagatgaagagtatgattcagatgacccccccagattctttgtcggggct
gaagaaggagaggatgaacctttggattccaccaagcctgaagaatttgagcacttctat
gaccccgccgaagaggaggaagatgaagagtatgattcaccacctgaaagacagattgta
gtgggcatatgttccatggcaaagaagtccaaatccaaaccaatgaaggaaattctggaa
cgtgtttccatgtttaaatacataatggttgtgatatttgaagaagatgttattttgaac
gaaccagtagaaaactggccattgtgtgattgtctcgtttcttttcattccaaaggattt
ccactggacaaagcagttgcctatgcaaagctcaggaatccatttgtcatcaatgacttg
aatatgcagtatcgcatacaggacaggagagaagtctatagtattctccaagctgaaggt
attttacttcctcgttatgcaattctgaatcgagacccaaataatcccaaagaatgcaat
ctggtcgaaggggaagatcacgttgaggtaaatggagcaattttccaaaagccatttgtt
gaaaagccagtcagtgccgaggaccataatgtttacatttattatccaacatctgctgga
ggagggagtcagaggctctttcggaagatcggcagcagaagtagtgtttactcccctgaa
agtaatgttcgaaaaacaggctcttacatttatgaggagttcatgcctacagatggaact
gacgtgaaggtatatacagtgggcccggactatgcccatgccgaagctcggaaatcccct
gctctagatggcaaagtggaaagggatagtgaagggaaggaagtccgttatcccgtcatc
cttaatgcaagagaaaaattaattgcttggaaagtctgcctcgcttttaagcaaactgtt
tgtggctttgacttattacgtgctaatggacagtcatatgtttgtgatgtcaacggcttc
agttttgtgaagaattctatgaaatattacgatgactgcgcaaaaatacttggaaatatc
ataatgagagagcttgctccacaatttcagatcccatggtcgataccattagaagccgaa
gatattccaattgtgccaaccacatctggaacgatgatggagcttagatgtgttattgca
gttatacgacacggggatcgaacaccaaaacaaaagatgaaaatggaagtgagacatcag
aagttttttgatctttttgagaaatgcgaaggctataagtccggaaagctaaaactgaaa
aagcctaaacaattacaggaagtgctggacattgctagacagcttcttttagaacttggg
cagaataacgattctgaaatcgaagagagcaaatcaaaacttgaacaactgaaaactgta
ttagaaatgtatggacatttttctggaataaatcgtaaagtccagttgacttatctccct
catggttgtcctaaaacatctagtgaagaggaagacactaggagagaagaaccttcatta
ctcttggttctgaagtggggcggggaattgacccccgccggccgagttcaagcggaggaa
cttgggagagctttcaggtgcatgtatcctggaggacaaggagattatgcaggatttcct
ggttgtggtttacttagactacatagtacttaccgacatgacctcaaaatatacgcttct
gatgagggacgagtccaaatgaccgctgcagcttttgcgaagggattattggctctagaa
ggagagcttacgcccattcttgtccagatggtaaaaagtgccaatatgaatgggcttttg
gacagtgacagtgactctctaagcagctgtcagcatcgtgtgaaagcaagacttcatgaa
attcttcagagagacagagagtttactactgaagactatgaaaagcttactccatctgga
agcatttctcttatcaagtcaatgcacctaatcaaaaacccagtgaagacctgtgacaaa
gtttattctttgattcagagtttgacttctcaaatcagacaaagaatggaagacccaaag
tattcagacattcagctttaccatagtgaaactctggaattaatgctacgtagatggtca
aaactggagaaggactttaagacaaagaatggaagatacgacatcagtaaaatcccagat
atttatgactgtataaaatacgacgtccaacataatggctccttgaaattagaaaacaca
atggaactatacagactttccaaggccttagcagatattgttatccctcaggaatatggt
atatcaaaagttgaaaaactagagattgccaaaggctactgcactcctttagttaggaag
attcgctcagatctgcagaggacacaagatgatgacactgtaaacaagcttcatcctctg
tattccagaggtgtgatgtctcctgagcgtcatgtccgaacgagactgtattttaccagc
gaaagtcatgtacactctttactgtccattcttcgttatggtgccttatgtgacgaatct
aaagatgatcaatggaaacgagctatggattatctcaacgttgtcaatgaactcaactac
atgactcagattgttatcatgctgtatgaggatccaaataaggatctttcctcagaggaa
cgttttcacgttgagctacactttagcccaggagccaaaggctgtgaagaagacaaaaat
ttaccctctgggtatggatacagacctgcctccagggagagtgatggctcaaagaaatcc
ccgcataaaaatgatagtgacgaggagccacatgcttctaaaagggatgaacctgatcga
gccgtactcatgttcaagcccatggtgtccgatcccattcacatacacagaaagtcacct
cttccccgatctaggaagattggtacaaatgaagaagagagccccctgagtgtgtctaac
ccagagggtactggtacctggctgcattacaccagtggtgtgggtactgggcgtcgaaga
cgcagatcaggggaacaaatcacttcttcccctgtctcccctaaatcattggctttcaca
tccagtatttttggctcatggcaacaggtggtttcagagagcagtagttacctccgaaca
ccaaggaccctggtggaacagaaacagaatgctctagggactcactgtgcgggcctgttt
agcacctcggtgctcgggggttcttcaagcgcgcctaacctacaggattatgctcgtact
catcgtaaaaagctgacttcttctggctgcatggatgggtttgaactgtattccatggtg
ccttctatctgccctctagaaactctacacaatgccctatctttaaagcaggtggacgac
tttctcgcttcagttgccatgccatcaaccgacagtcggctagagacaccgtctgctctt
tcctctccttcatgttctagtccacattctagaagaaaaatgtctttaaatacttacact
cctgcaaagatcctccctacacctcttgcgcctgtgcagcatgggaaagcagccggtaaa
tcagctttatgtgagattttaattcttttgtggctggctgacaatccggaaccggtggga
cctctggcaaatctccagctagtacctcatctcctaagcagagtccacatgtccgaggag
aggacagagcgactaaagacaaagcgactaaaccgaagaagtaaaatccttcaaagaaaa
ccgcaaccgtgcactcgtttatacagttcgaaacattgttcagagctggaacacgttttt
gtaaatatgcagggatggattctggcagtagaaattgtaaatagcagtcacctagctcac
ggtggtgccgacccttttccttctaaggaactcaatccgaaaagtgggaacggcagcgtt
agcaggagggaactgcgtgatgggctgcagctactctccaaactgtggtag

DBGET integrated database retrieval system