KEGG   Ornithorhynchus anatinus (platypus): 100074233Help
Entry
100074233         CDS       T01045                                 

Gene name
GUK1
Definition
guanylate kinase 1
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100074233 (GUK1)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     100074233 (GUK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 247 aa AA seqDB search
MSWCSLPRAAAAMAARPRPVVLSGPSGAGKSTLLRKLFQEYGNVFGFSVSHTTRSPRPGE
ENGKDYHFVSREAMLRDIEANEFIEHAEFSGNMYGTRCGTRSRRGEKRLRDRKTETEESL
QKRLAAARADMESSKEPNLFDLIIINDDVEEAYCSLRGVLAEVRGRPFPFPPLSPPPPSR
ASLDPSPRPERSPFPSALGRGSSGNQPDQSDQLARFFWSGQGPRGERAVKTVPGWGPEAA
GPPGTVQ
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagctggtgttcgctccccagagcggcggcagccatggcggccaggccccgacccgtg
gtcctgagcggcccctcgggcgcggggaagagcacgctgctccgcaagctcttccaagaa
tacggcaacgtcttcggcttcagcgtctcccacaccacaaggagccccaggcccggagag
gagaacggcaaagattaccacttcgtgagccgcgaagccatgctgcgagacattgaggcc
aacgagttcatcgagcacgcggagttctccgggaacatgtacggcacgaggtgcggcacg
aggtcacggcggggagaaaagcggctgagggacaggaagacggaaacggaggagagctta
cagaagaggctggccgccgctcgggccgacatggagagcagcaaggagcccaatctcttc
gatctgataatcatcaacgacgacgtggaggaagcttactgttccctcagaggggtcctg
gctgaggtgaggggccgtcccttccccttcccacccctctccccgccgccgccctcccgc
gcctctctcgatccctccccgcgccccgaacgctcccccttcccatccgcccttggccga
ggaagcagcgggaaccagccagaccagtcagaccagctggctcgtttcttctggtccggc
caaggcccgcgaggggagcgggcggtcaaaacagtccctggttgggggccggaggcagct
ggacccccaggcaccgtgcagtga

DBGET integrated database retrieval system