KEGG   Ornithorhynchus anatinus (platypus): 100074279Help
Entry
100074279         CDS       T01045                                 

Definition
cytochrome P450 2C6-like
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100074279
   00590 Arachidonic acid metabolism
    100074279
   00591 Linoleic acid metabolism
    100074279
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100074279
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100074279
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100074279
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100074279
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100074279
Cytochrome P450 [BR:oaa00199]
 Cytochrome P450, animal type
  CYP2 family
   100074279
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 223 aa AA seqDB search
SHVPLLSHRPQERQQPESEFTLENLKMCVYDLFLAGTETVSITLRYALLTLLKYPAVAGD
VAGTPPLIIIAVPDRASVSFSALPAPTSCSCPPDTRAGPDQTPSLPPPNSTPALFQGTTV
YPVLGSVLNDPQQFPEPERFAPEHFLDAKGAFKKSGAFMVFSAGKRNCVGEGIARMELFL
FLTTLLQNLRLSPPPGVRAVDVQPGISGVANLPPPFQICVTPH
NT seq 674 nt NT seq  +upstreamnt  +downstreamnt
cttcccacgtccccctcctgtcccaccgtccccaggagcggcagcagccggaaagcgagt
tcacgctggagaacctgaagatgtgtgtctacgatctcttcctggccggcaccgagacgg
tcagcatcaccctgcgctacgccctcctcaccctgctcaagtacccggccgtggcaggtg
atgtggcgggcacaccaccgctaataataattgcagtacctgaccgggccagcgtctcat
tctcggctctcccagcgccgacctcttgctcgtgcccccctgacacccgggcaggaccgg
accagaccccctccctaccacctcccaactcaacacccgcactcttccagggcacgacgg
tctacccggtcctgggctccgtcctcaacgacccacagcagttcccagagcccgaacgct
ttgccccagaacacttcttggatgccaagggagcctttaagaagagcggagccttcatgg
tcttctctgcaggcaagcggaactgtgttggcgagggcatcgcccgcatggagctcttcc
tcttcctcaccacgctgctgcagaacctccggctgagcccacccccgggggtccgggccg
tggacgtgcaacccgggatcagcggcgtggccaacctgccaccccccttccagatctgcg
tcaccccgcactga

DBGET integrated database retrieval system