KEGG   Ornithorhynchus anatinus (platypus): 100074395Help
Entry
100074395         CDS       T01045                                 

Gene name
PPP1CC
Definition
protein phosphatase 1, catalytic subunit, gamma isozyme
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
mRNA surveillance pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Hippo signaling pathway
Focal adhesion
Platelet activation
Long-term potentiation
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Oxytocin signaling pathway
Amphetamine addiction
Alcoholism
Herpes simplex infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    100074395 (PPP1CC)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    100074395 (PPP1CC)
   04024 cAMP signaling pathway
    100074395 (PPP1CC)
   04022 cGMP - PKG signaling pathway
    100074395 (PPP1CC)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100074395 (PPP1CC)
  Cell growth and death
   04114 Oocyte meiosis
    100074395 (PPP1CC)
  Cellular commiunity
   04510 Focal adhesion
    100074395 (PPP1CC)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100074395 (PPP1CC)
  Endocrine system
   04910 Insulin signaling pathway
    100074395 (PPP1CC)
   04921 Oxytocin signaling pathway
    100074395 (PPP1CC)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100074395 (PPP1CC)
   04270 Vascular smooth muscle contraction
    100074395 (PPP1CC)
  Nervous system
   04728 Dopaminergic synapse
    100074395 (PPP1CC)
   04720 Long-term potentiation
    100074395 (PPP1CC)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100074395 (PPP1CC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100074395 (PPP1CC)
  Substance dependence
   05031 Amphetamine addiction
    100074395 (PPP1CC)
   05034 Alcoholism
    100074395 (PPP1CC)
  Infectious diseases
   05168 Herpes simplex infection
    100074395 (PPP1CC)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100074395 (PPP1CC)
Protein phosphatases and associated proteins [BR:oaa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     100074395 (PPP1CC)
Transcription machinery [BR:oaa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     100074395 (PPP1CC)
Spliceosome [BR:oaa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100074395 (PPP1CC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 319 aa AA seqDB search
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNASRPVTPPRGFILQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcggatatagacaagctcaacatcgacagcatcatccaacggctgctggaagtaagg
ggttcaaagcctggtaaaaatgtccagttgcaagagaatgagatacgaggattgtgcttg
aagtctcgagaaatttttctcagccagcctatcctattagagctcgaagcacctcttaaa
atatgtggtgatatccacggacagtactatgatttgcttcgactctttgaatatggtggt
ttcccacctgaaagcaactacctgttccttggagattatgttgaccgggggaaacagtcc
ttggaaaccatctgtcttcttctggcctacaaaataaaatacccagagaatttttttctt
ctcagaggaaaccatgaatgtgccagcattaatagaatttatggattttatgatgaatgt
aaaagaagatataacattaaactatggaaaacctttaccgactgctttaactgtttgcct
attgcagctattgtggatgagaaaatattctgttgtcacggaggtttgtcaccagatctt
cagtcaatggagcaaattcggcgaattatgcgccctaccgatgtacctgatcagggtctt
ctttgtgatctcttgtggtctgaccctgacaaagatgttttgggctggggtgaaaatgac
agaggagtgtcttttacatttggagccgaagttgttgcaaagtttcttcataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggatatgagttttttgcaaag
aggcagttagtcactttgttttcagctccaaattattgtggagagtttgacaatgcagga
gccatgatgagcgtggatgaaactttaatgtgctcttttcagattttgaaacctgcagag
aaaaagaagccaaatgccagcagacctgtaacaccaccaaggggctttattctgcaatga

DBGET integrated database retrieval system