KEGG   Ornithorhynchus anatinus (platypus): 100074402Help
Entry
100074402         CDS       T01045                                 

Definition
protein-arginine deiminase type-2-like
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 338 aa AA seqDB search
MGPFEEFCAPFGAQSSPSLKAQKMLEERESSRGFEVLSSNAAPAEARTFGLKYTAGVRVD
VVKNGQAEETTRNGKRRWAISSDTTLSLSMNQASAEASDHKVTVSYFGEEGNLPIDQAGV
FLTAIEISLDVDADRDGVVEKNNPRKGSWTWGPDGQGAILLVNCDRETPWLPEGDSADEK
IYSKEDLNDMSRMILRTRGPDRLPFGYEMVLYISMSDSDKVGVFYVDMPHFASLHEYSCA
SGFFFVLDPSDINESSLSFGISGEYLGVPRTPIFTDTVTFRVAPWIMTPNTLPPVDVFVC
NVKDNYLFLKELKSLVEKARCNLKVCFRYMNRGDRWMQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgggtccttttgaggaattttgtgccccttttggagcacaaagctcaccatccttaaag
gcccaaaagatgctggaggagagagaatcctccaggggctttgaggtgctgagctccaat
gcggctccagctgaggcccggacctttggcctgaagtacacagccggggtgcgggtggac
gtggtgaaaaatgggcaggcggaagagacaactagaaatggcaaacggcgctgggccatc
tcctcggacaccaccctgagcctcagcatgaaccaagccagcgccgaggccagtgaccat
aaggtcactgtcagctacttcggggaggaagggaacttgccaatcgaccaggccggggtc
ttcctcactgccatcgagatctctctggacgtggatgcagaccgtgatggcgtagtggag
aagaacaaccccaggaagggttcttggacctggggccctgatggacagggggccatcctg
ctggtgaactgtgaccgggagaccccctggctgccagagggggacagcgccgacgagaag
atctatagcaaggaagatctgaacgacatgtcccggatgatactaaggacgcgtggccct
gataggctcccgtttggctacgagatggtcctctacatctccatgtcagactccgacaaa
gttggcgtgttctacgtggacatgccccatttcgcaagtctccatgaatacagctgtgca
tcaggatttttctttgttctggatcctagcgacattaacgagagcagtttatcctttggt
atttctggggaatatttgggtgttcctcggacccccatcttcacagacactgtgaccttc
cgagtggctccgtggatcatgacccccaacaccctgcctcccgtggatgtgtttgtctgc
aacgtgaaggataactacctgttcctgaaggagctgaagagtctggtggagaaagctcgc
tgcaacctaaaggtctgcttccggtatatgaaccgtggggaccgctggatgcag

DBGET integrated database retrieval system