KEGG   Ornithorhynchus anatinus (platypus): 100074562Help
Entry
100074562         CDS       T01045                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase-like
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 278 aa AA seqDB search
MSGARARGVGGAGAGGGAGGASEVLLLLAKLVGGAALVQTGLYLLRRLCLAMAWKSGGAS
HAELIHNLRKNGIIKSDKVFEVMLATDRCHYAKCNPYMDSPQSIGFQATISAPHMHAYAL
ELLFEQLHEGAKALDVGSGSGILTACFSRMVGPIGKVVGIDHIKELVDDSINNVKKDDPS
FLTSGRVKLIVGDGRMGYPEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGN
QMLEQYDKLEDGSVKMKPLMGVIYVPLTDKEKQWSRWK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggagcgcgcgcgcggggcgtagggggcgcgggcgcgggcgggggcgcgggcggg
gcgtcggaggtgctgctgctgctggccaagctggtgggcggcgcggcgttggtgcagacg
ggcctctacctgctgcggaggctgtgtctcgccatggcctggaagtccggcggcgccagc
cacgccgagctcatccacaacctccgcaaaaatggaataatcaaatcagataaagtattt
gaagtaatgctggccacagaccgctgccactatgcaaagtgtaatccttacatggactct
ccacaatcaataggttttcaagcaacaatcagtgctccacacatgcatgcctatgctcta
gaacttctatttgaacaattgcacgaaggagccaaagctcttgatgtgggatctggaagc
ggaatcctcaccgcctgcttttcacgcatggttggtcccattggaaaagttgtaggaatt
gatcatatcaaagagttagtagatgactctataaataatgtcaaaaaggatgatccctcg
tttttgacttctggacgagtgaaattgatcgtgggggatggaagaatgggctatccagaa
gaagctccctacgatgctatccacgtgggtgccgccgcaccagttgtaccccaagcactt
atagatcagttaaaacctggtggaagattgatattaccagttggtcccgcaggaggaaac
cagatgctggaacagtatgacaagctagaagacggcagcgtcaaaatgaaaccattgatg
ggggtgatatatgtgcctttaacagataaagagaagcaatggtccaggtggaagtga

DBGET integrated database retrieval system