KEGG   Ornithorhynchus anatinus (platypus): 100074562Help
Entry
100074562         CDS       T01045                                 

Gene name
PCMT1
Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100074562 (PCMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 227 aa AA seqDB search
MAWKSGGASHAELIHNLRKNGIIKSDKVFEVMLATDRCHYAKCNPYMDSPQSIGFQATIS
APHMHAYALELLFEQLHEGAKALDVGSGSGILTACFSRMVGPIGKVVGIDHIKELVDDSI
NNVKKDDPSFLTSGRVKLIVGDGRMGYPEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLI
LPVGPAGGNQMLEQYDKLEDGSVKMKPLMGVIYVPLTDKEKQWSRWK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcctggaagtccggcggcgccagccacgccgagctcatccacaacctccgcaaaaat
ggaataatcaaatcagataaagtatttgaagtaatgctggccacagaccgctgccactat
gcaaagtgtaatccttacatggactctccacaatcaataggttttcaagcaacaatcagt
gctccacacatgcatgcctatgctctagaacttctatttgaacaattgcacgaaggagcc
aaagctcttgatgtgggatctggaagcggaatcctcaccgcctgcttttcacgcatggtt
ggtcccattggaaaagttgtaggaattgatcatatcaaagagttagtagatgactctata
aataatgtcaaaaaggatgatccctcgtttttgacttctggacgagtgaaattgatcgtg
ggggatggaagaatgggctatccagaagaagctccctacgatgctatccacgtgggtgcc
gccgcaccagttgtaccccaagcacttatagatcagttaaaacctggtggaagattgata
ttaccagttggtcccgcaggaggaaaccagatgctggaacagtatgacaagctagaagac
ggcagcgtcaaaatgaaaccattgatgggggtgatatatgtgcctttaacagataaagag
aagcaatggtccaggtggaagtga

DBGET integrated database retrieval system