KEGG   Ornithorhynchus anatinus (platypus): 100074625Help
Entry
100074625         CDS       T01045                                 

Gene name
RXRA
Definition
retinoid X receptor, alpha
Orthology
K08524  
retinoid X receptor alpha
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
PPAR signaling pathway
PI3K-Akt signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Bile secretion
Hepatitis C
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100074625 (RXRA)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    100074625 (RXRA)
   03320 PPAR signaling pathway
    100074625 (RXRA)
   04919 Thyroid hormone signaling pathway
    100074625 (RXRA)
  Digestive system
   04976 Bile secretion
    100074625 (RXRA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100074625 (RXRA)
   05202 Transcriptional misregulation in cancers
    100074625 (RXRA)
   05216 Thyroid cancer
    100074625 (RXRA)
   05222 Small cell lung cancer
    100074625 (RXRA)
   05223 Non-small cell lung cancer
    100074625 (RXRA)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100074625 (RXRA)
  Infectious diseases
   05160 Hepatitis C
    100074625 (RXRA)
Transcription factors [BR:oaa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100074625 (RXRA)
Nuclear receptors [BR:oaa03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100074625 (RXRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 433 aa AA seqDB search
MAAPSLHQSLGPGIGSSLGSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGT
GSPQLNSPMNPVSSTEDIKPPLGLNGVLKVPAHPSGTMASFTKHICAICGDRSSGKHYGV
YSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEER
QRGKDRNENEVESTSSANEDMPVEKILEAELAVEPKTETYIEANMGLNPNSPNDPVTNIC
QAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATG
LHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEV
EALREKVYASLEAYCKHKYPDQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT
FLMEMLEAPHQMT
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgccctccctccatcagtccctcggccccggcatcggctcctccctggggtca
cccatcagcaccctcagctctcccatcaatggcatggggcccccgttttccgtcatcagc
tcccccatggggccacactcgatgtcggtccccaccacccctaccctcggatttggcacg
ggcagtcctcagctcaactctcccatgaaccccgtgagtagcacagaagacatcaagccc
cccctcggactcaatggagttcttaaagtgcccgcacacccctcaggaaccatggcctct
ttcaccaagcacatatgtgccatctgtggggaccgatcatcaggtaaacactatggtgtg
tacagctgtgagggctgcaaaggttttttcaaacgcacggtgcgcaaggatctcacgtat
acttgccgcgacaacaaggactgtctcatcgacaaacgccagcggaaccggtgccagtat
tgccgataccagaagtgtctcgcgatgggcatgaaacgagaagctgtgcaggaggagagg
cagcgagggaaggatcggaacgagaatgaggtggagtcaacgagtagcgccaatgaggac
atgcctgtggagaagatcctggaagccgaactggcagtagaaccaaagacagaaacatat
atcgaggcgaacatgggattaaaccccaattcgcccaatgaccctgtcaccaacatatgt
caagcagcagacaaacagctcttcaccttggtggaatgggccaagaggattccccatttc
tcagaactgcccttggatgaccaggttattctgttaagagcaggctggaatgagctgctc
atcgcctccttctctcaccgctcaatagcagtgaaagatggcatcctcctcgccacaggc
ctgcacgtccatcggaacagtgcccacagcgcgggagtcggcgccatcttcgacagagtc
ctgacagaactcgtgtccaaaatgcgagacatgcagatggacaagacggagttgggctgc
ttgcgagccatcgtcctcttcaaccctgactcaaagggcctctccaaccctgccgaggtt
gaggctctgcgggagaaagtttacgcatccctcgaggcttactgcaaacacaagtatccc
gaccagccaggaaggtttgcaaagctcttgctccgtctccctgccctccggtccatcggc
ctgaaatgcctcgagcacctcttcttcttcaaactaataggcgacacgcccattgacacc
tttctgatggagatgctggaagcgccacaccaaatgacttag

DBGET integrated database retrieval system