KEGG   Ornithorhynchus anatinus (platypus): 100074666Help
Entry
100074666         CDS       T01045                                 

Gene name
DHCR7
Definition
7-dehydrocholesterol reductase
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Steroid biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    100074666 (DHCR7)
Enzymes [BR:oaa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     100074666 (DHCR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 521 aa AA seqDB search
MDCLPVIGLRTEHVRYGVGPPTWAFPCNSAKIKDRPCQEPQDDEVPMATGSTTNSSKSKN
KNGISDKNKALQGQWGRAWEVDWFSLASVIFLLMFAPFIVYYFIMACDQYQCALTTPLVD
LFTGNNHLSDIWAKTPSMSQKAAQIYTAWVIFQVLLYILLPDFCHKFLPGYVGGVQEGAI
TPSGTVNKYEINGLQAWIITHLLWFANAHFFHWFSPTVIFDNWIPLLWCANILGYIVSIF
VMIKSYLFPSNSKDCKFTGNFFYDFMMGVEFNPRIGKWFDFKLFFNGRPGIVAWTLINLS
FAAKQQELYGQVTNSMILVNVLQGIYVLDFFWNEAWYLKTIDICHDHFGWYLGWGDCVWL
PYLYTLQGLYLVYNPIQLSVPHAMGVLLLGLVGYFIFRVTNHQKDLFRRTDGNCKIWGKK
PEYIECSYMSVDGKKHYSKLMISGFWGVTRHFNYTGDLMGSLAYCLACGFNHIFPYFYII
YMSILLIHRCIRDEHRCSSKYGKDWKRYTSAVPKRLVPGIF
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggactgtctaccagtgattggattgcggactgaacacgtcagatatggggtggggcct
ccgacctgggctttcccttgtaattctgccaaaatcaaggacagaccgtgtcaggagccg
caggacgacgaggttccaatggctacaggctccacaacaaattcttcaaaatccaagaac
aaaaatgggatttctgacaaaaataaagcacttcaaggacagtggggaagagcctgggag
gtggattggttttccctagcaagtgtcatattcctgctgatgtttgctccatttattgta
tattactttatcatggcatgtgaccagtaccaatgtgctcttactacccctcttgttgat
ctcttcactgggaataatcatctttctgacatctgggcgaagacaccatcaatgagccag
aaagctgctcagatctacacagcttgggtcattttccaggtccttttgtacatattgctt
cctgatttttgtcataaatttctgcctggctatgtaggaggagtacaagaaggtgccata
actccttcagggacagtaaataaatatgaaatcaatggccttcaagcctggataattact
catcttctctggtttgcaaatgcacatttcttccactggttctctcctactgtaatcttt
gacaactggatcccactgctctggtgtgccaatattcttggctatatagtttccatattt
gtaatgatcaagagctatcttttcccttcaaattcaaaagactgcaaatttactggtaac
ttcttctacgatttcatgatgggtgttgaatttaatcctcgaataggaaaatggtttgat
ttcaagcttttcttcaatggacgcccaggcattgtagcatggactcttattaacttgtca
tttgcagccaagcagcaggaactctatggtcaggtgaccaactccatgatcttggttaat
gttctacagggcatttatgttttggactttttctggaatgaagcatggtacctgaaaacc
atagacatctgccatgatcactttgggtggtatttgggttggggagactgtgtctggcta
ccatacctctatactcttcagggtttatacttggtgtacaaccccatacagctctccgta
cctcatgcgatgggcgtcctgctgttaggtttggtaggttactttatcttcagggtgacc
aatcaccagaaagaccttttccgacgcaccgatgggaattgcaagatctggggcaagaag
ccagaatacatagaatgttcctacatgtcagtggatgggaagaagcactacagcaaactg
atgatttcaggattctggggtgtgacccgccattttaactataccggggacttaatgggc
tccttagcctactgcctggcttgtggctttaaccatatctttccttacttctacatcatc
tacatgtccatcttgttaattcaccgctgtatcagggatgagcaccgttgttctagcaag
tatggtaaagactggaaacgatatacctctgcagtgcccaagcgactggtgccaggaatt
ttctaa

DBGET integrated database retrieval system