KEGG   Ornithorhynchus anatinus (platypus): 100075036Help
Entry
100075036         CDS       T01045                                 

Gene name
GK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100075036 (GK)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100075036 (GK)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     100075036 (GK)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100075036 (GK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 619 aa AA seqDB search
MAFLHLLQDVSFRDVIAQDYELSPTVSLARFLTDSWELVGSTLCFSFPLAFRVFSLQVFN
AKTAELLSHHQVELKQEFPKEGWVEQDPKEILQSVYECIEKTCEKLVQLNIDISNIKAIG
VSNQRETTVVWDKFTGEPLYNAVAAPVSGGFPVPAAGAPSGSPSVWLDLRTQSTVEALAQ
KIPGNNNFVKSKTGLPISTYFSAVKLRWLLDNVEEIRKAVEDDRAMFGTIDSWLIWSMTG
GKNGGVHCTDVTNASRTMLFNIHTLEWDPELCQFFEIPMEILPSIRSSSEIYGLMKISRS
LKAGALDGVPISGCLGDQSAALVGQMCFQNGQAKNTYGACYRLPYGTGCFLLCNTGQKSV
FSDHGLLTTVAYKLGRDKPVCYALEGSVAIAGAVIRWLRDNLGIAKSSDEIEKLAQEVGT
SYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKNHIAFAALEAVCFQTREILDAMNKD
CGIPLSHLQVDGGMTNNKILMQLQADILCIPVVKPSMPETTALGAAMAAGSAEGVAVWSL
DPEDLSAVTMERFEPQINEEESEVRYATWKKAVAKSMGWATAQTSSQGDPSIFCSLPLGF
FIVSSMIMLIGARHISGVP
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggcctttctccacttgttgcaagacgtctccttccgagacgtcattgcgcaagattac
gaactctcccccaccgtctccctggccagatttttgaccgactcttgggagctggtcggc
tccaccctctgctttagtttccctttggcattccgtgttttttctttacaggttttcaat
gcaaaaacagcagaactccttagccatcatcaagtggaactgaaacaggagtttccgaaa
gaaggatgggtggagcaagatccgaaggagattctgcagtctgtctatgagtgtatagag
aaaacctgtgagaaacttgtccagctcaatatcgacatctccaacatcaaagccatcggt
gtcagcaatcagcgggaaaccaccgtggtctgggacaagttcaccggagagcccctctac
aatgccgtcgctgctcccgtctctggtggttttcccgttccagctgccggtgctccgtcc
ggttctccctcagtgtggctcgacctaaggactcaatccacagtcgaagctcttgcccag
aaaattccaggaaataataactttgtcaagtctaagacgggtctccccatcagcacttac
ttcagtgccgtgaaactgcgctggctccttgacaacgtggaagaaatccgaaaagccgtc
gaagacgatcgagctatgtttggtaccatcgactcctggctcatttggagtatgaccggc
gggaagaacggaggcgtccactgcacggatgtgaccaacgccagccggaccatgctgttc
aatatccacaccctggaatgggatcccgagctctgccagtttttcgaaatccctatggaa
atacttccgagcatcaggagttcctcagagatctacggcttgatgaaaatctctcgtagc
ctgaaagccggagccttggatggagtgccgatctccgggtgtctgggggaccagtcggcc
gctcttgtcggacagatgtgtttccagaacggacaagccaaaaatacatacggagcttgt
tacagactaccgtatgggacaggctgtttcttgctgtgtaacacaggccaaaagtcggtg
ttttccgatcatggcctgctaaccacggtggcttacaaactgggcagagacaagccagta
tgctacgcgttggaaggatcggtcgcgatagccggcgctgtgattcgctggctgagagac
aacctcggcatcgccaagtcgtccgacgagatcgaaaaactggctcaagaagtggggacg
tcttacggctgctatttcgtcccggccttctccggactgtacgcaccctactgggaaccc
agcgccagggggatcatctgcggcctgacccagttcaccaacaagaaccacatcgccttt
gccgcgttggaagcggtctgcttccaaacccgagagattttagatgctatgaacaaagat
tgtggaattcccctgagccacttgcaagtcgacggcgggatgaccaacaacaaaatcctc
atgcaacttcaggccgacatcctctgcattccagtggtcaagccctccatgcccgagacc
acggccctgggggccgccatggccgccggctcggcggaaggagtggccgtctggagcctg
gaccccgaggacctgtcggccgtcaccatggagcgcttcgagcctcagataaacgaagag
gagagcgaagtccgctacgccacgtggaagaaggcggtggcgaagtcgatgggctgggcc
accgctcagacgagctcgcagggtgaccctagtatcttctgtagtcttcccctgggcttt
tttatagtgagtagcatgataatgttaatcggagcaaggcacatctcaggggttccgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system