KEGG   Ornithorhynchus anatinus (platypus): 100075046Help
Entry
100075046         CDS       T01045                                 

Gene name
KAT6B, MYST4
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100075046 (KAT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 1858 aa AA seqDB search
MVKLANPLYTEWILEAIQKVKKQKQRPSEERICHAVCASHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSLVKPGTFPKSAKGARGSCNDLRNVDWNKLLRRAIEGLQE
PNGSSLKNIEKYLRSQSDLSSTTNNPVFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLE
GKGASKYSSAFPSSLPPVSLLPHERDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRIQGKNAENMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRMLSVTSDE
GSMNAFTGRGSPGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDPSRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLA
PDTEIKINIKQESADVNVVGSQDIVSEEDLDVFKQAQELSLEKIGCKSGVESNGRYPSVI
EFGKFEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANEIYR
RNDISVFEVDGNVSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLVGYF
SKEKLCQQKYNVSCIMIMPQYQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRLSYL
AYWKSVILEYLYHHHEKHISIKGISRATGMCPHDIATTLQHLSMIDKREEKFVIIRREKL
ISGHMEKLKTNARINELDPESLRWMPLLVSNAAVSEEELETEKEAEHLMEQGGSWEKEEP
EVVATRTNTKQSPAKVQEEEEEEEVEEEEEEEDHQPSSPPRLTKPQSLVVSRKRPFILKK
KRGRKRRRINSSVTTETISETTEVLNEPFENSDEERPMPQLEPTCEIEGEEDDLKPVIRK
MFQYQPGKQRQEEEEKEKDNHCYKNDEPGRNNPEGANSLNDVTKDNPEPLRCKQGWPKGV
KRGPSKWRQNKERKMGFKLNLYTPPETPMEPDCQVTVEEQKEASEEKPCQIPVVAEEAIK
ESSLPPVQPQDENGEEISAPPSPNKITFEKSENGVATKAEEEEEEEEEEEEGEGEEEEVE
EEEEEEEEEEEEEEREGDAESDNTKSQEKDQPETCAEKKDPAAVDDHEEEEEEDEEPSHN
EDHDADDEDDGHMDPAEAEKEELAGEAFKEALENQETFLDLSVQTGNSKPEELIDCGVDL
SAPRTGESKEGAADAEDVPGPDEEDVERRADRDRKDSEELNPEFKGEATETMELDSETAQ
AVQSLTQENGEQDDTFQDCSETQAACRSLQNYTRADQSPQISALDDCQQSDHSSPVSSVH
SQPGQSARSVSSPTVPTLENGYAQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVD
SGFSDLGSIESTTENYENPSSYDSTMGGSICGNNSSQNSCSFSSLTSSNLTQSSCAVTQQ
MSSINGSCSMMQQTGIGSPPTCNVKSPQGCVAERPPSGSQQLPQCSMAANFTPPMQLAEI
PETGGANVGLYERMGQGEFGPGHYPQPSATFSLAKLQQLTNTLIDHSLPYSHSAAVTSYA
NSASLPTPLSNAGLVQLSQSPHPVPGGAQAQATMTPPPNLTPPPMNLPPPLLQRNMAASN
IGLSHTQRLQTQIAGKGHVSMRTKSAALPPAAAAAAAAAAAAHQSQIYGRASQAVAMQGP
ARTLTMQRGMNMSVNLMPAPAYNVNSVNVNMNTLNAMNGYSMPQPMMNSGYHGNHGYMNQ
TPQYPMQMQMGMMGTQPYAQQPMQATPHSNMMYTPPAHHGYMNTGMPKQSLNGSYMRR
NT seq 5577 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgccaacccactttacacagagtggattcttgaagctatacaaaaggtc
aaaaagcagaagcagaggccatccgaagaaagaatctgccatgcagtctgtgcttcccat
ggattagataagaagacggtctctgagcagttggagctgagcgttcaagatggctctgtt
ctcaaagttaccaacaaaggcctcgcgtcctataaggacccagacaatcctgggcgtttt
tctttggttaaaccaggcacttttcccaaatcagctaagggggccagggggtcatgtaat
gatctgcgcaacgtggattggaataaacttttaagaagagcaatcgaagggctccaggaa
ccaaatggctcctccctgaagaatattgagaagtatctccgcagtcaaagcgatctgtcg
agcactaccaacaaccccgtatttcagcaacgattacgactgggggccaaacgtgctgta
aataatgggaggttactgaaagatggacctcaatatagggtgaattatggtagtttagaa
ggcaaaggagcctcaaaatattccagtgctttcccatcctctctaccacctgtcagcctt
ctaccccatgagagagaccagcctcgagctgatcccattccaatatgtagcttctgtttg
gggactaaagaatcaaatcgtgagaaaaaaccagaagaactcctttcttgtgcagactgt
ggcagtagtggacatccgtcatgtttaaaattctgtcctgagttaacaacaaatgtaaaa
gccttacgatggcagtgtattgaatgcaagacatgcagcgcatgtagaatccaaggcaaa
aatgcagaaaatatgcttttttgtgactcttgtgatagagggttccatatggagtgttgt
gacccaccgctttccagaatgcccaaaggaatgtggatttgccaagtctgcagaccaaag
aaaaagggaagaaaactgcttcatgagaaagctgcacaaataaaacgacgatatgcaaaa
cctattggacgaccgaaaaataaactaaagcaacgaatgttgtctgtaaccagtgatgaa
ggatccatgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatctggtcatgctgcatctgggaaggactcgagcagcagattggct
gtcacagacccctctcggcctggtgccaccaccaaaatcaccaccacctccacctacata
tctgcctctacacttaaagttaacaagaaaaccaaagggctcattgatggcctgactaag
tttttcacaccatcccctgatggtcgcagatcacgaggtgaaataatagacttttcaaag
cactatcgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcatgtgttggct
ccagatactgaaatcaaaataaacatcaaacaagaaagcgcagatgtaaatgtggttgga
agccaggacatcgtttcagaagaggatttggatgtctttaaacaggcacaggaactctct
ctagagaaaataggatgtaagagtggtgtggagtcaaatggacggtacccttcagtaata
gaatttggaaagtttgaaatccagacctggtactcttcgccatacccacaggaatatgca
agattaccaaagctttacctgtgtgaattctgtctgaagtatatgaaaagtaaaaacatt
ttgctaagacattcaaagaagtgtggatggtttcatcctccagcaaatgaaatctacagg
aggaatgacatttcagtatttgaggttgatggaaatgtgagcaaaatttattgccaaaac
ctttgtttgctagccaagctcttcctggaccacaaaacattatattatgatgttgagccg
ttccttttttatgttcttacaaaaaatgacgagaagggctgtcatctggttggatacttc
tctaaggaaaagctttgccagcagaagtacaatgtctcctgcataatgattatgccccaa
taccaaaggcaaggatttggaaggtttctcattgatttcagttatttgctttctagaaga
gaaggacaagcaggatctcctgaaaagcccctttctgatctgggtcgtctctcatatctg
gcctactggaagagcgtcatattagaatacctctatcaccaccacgagaaacacatcagc
atcaaggggatcagccgggctactggcatgtgtcctcatgatattgccacaactctgcag
catctcagtatgattgacaagagagaagaaaaatttgtaatcattagaagggagaagctg
atatccggccatatggagaagctgaaaactaatgcccgcattaacgaacttgaccctgag
agtctaaggtggatgccattgttggtttccaatgcagcagtttctgaagaagagcttgaa
actgaaaaagaggccgaacatctgatggagcaaggtggctcttgggaaaaagaagagccg
gaagtcgtagccacacgaactaatactaagcaatcacctgcaaaagtacaagaagaggag
gaagaagaggaggtggaggaagaggaagaagaggaagatcatcaacccagctctcctccg
aggctgacaaaaccccagtctcttgtagtaagcagaaagagaccttttatcctaaagaag
aaaaggggtcgtaagcgaaggaggatcaacagcagtgtcaccacagaaacaatttctgaa
actaccgaagtactgaatgagccatttgaaaattcagatgaagagaggcctatgccgcag
ctggagcctacctgtgaaatcgagggggaagaagatgacctaaagccagtaattagaaaa
atgtttcagtatcaacctgggaagcaaagacaagaagaggaagagaaggagaaagacaat
cattgctataagaatgatgaaccaggtagaaacaaccccgaaggagcaaatagtctgaac
gatgttactaaagacaatcctgaacctctgagatgcaaacaaggttggcccaaaggagtg
aagcgtggcccatctaaatggaggcaaaataaagaaaggaagatgggttttaaacttaat
ttatacacaccccctgagactccaatggaacccgactgccaggtgacagtagaagaacag
aaagaagcttctgaagagaaaccatgccagattcctgttgtagcagaggaggccattaaa
gaatcatctcttccacctgtacaaccccaagatgaaaatggagaagagatatccgcgcct
ccaagccctaacaaaataacttttgaaaaatccgagaatggtgtagcaaccaaagcggag
gaagaggaagaagaggaggaggaggaggaggaaggagagggggaggaggaagaagtagag
gaagaggaggaggaggaggaggaggaagaagaggaggaagagagagaaggagatgcagag
agcgacaacaccaaaagtcaggaaaaagaccaaccagaaacctgtgccgaaaaaaaagac
cccgcggccgtcgatgatcacgaagaggaagaagaagaggacgaagagccatcccacaac
gaagatcacgacgcagatgacgaagacgatggtcacatggacccggccgaagccgagaag
gaagagcttgcaggagaagctttcaaggaagctctggagaatcaggagacttttttagac
ctaagcgttcaaactggtaattccaaaccggaggagttaatcgactgtggtgttgacctt
tcggcgccccgtaccggcgagtcaaaggagggtgccgccgacgcggaagatgtgcccgga
cccgacgaggaagatgtagaacggagagccgaccgggatcggaaagatagcgaggaatta
aatcctgaattcaaaggagaagctaccgaaactatggagctagactcggagaccgcccaa
gccgttcagtccctgacccaggaaaacggcgaacaggatgatacttttcaagattgttcg
gagacgcaggcggcctgtagaagtctccagaactacacgcgtgccgaccagagtccccag
atctccgccctggatgactgccagcagtctgaccacagcagccccgtttcgtccgtacat
tcgcagcccggtcagtccgcgcgctccgtaagtagcccgacggttcctacgttagagaac
ggctacgctcagatcagcccagatcagagcgccatctccgtgccctccctccagaacatg
gagaccagtccgatgatggacgtcccctcggtctccgatcactcccagcaagtcgtcgac
agcgggttcagcgatctgggcagcatcgagagcacgaccgaaaactacgagaacccgagc
agttacgattccaccatgggagggagtatctgtggcaataattcttcccagaacagctgc
tcgttcagcagtctcacgagcagcaacctgacgcagagtagctgcgccgtcacccagcag
atgtccagcatcaacgggagctgcagcatgatgcagcagacgggcatcggctctcccccg
acctgtaacgtcaagtctccccagggttgcgtggcggagaggcctccgagtggcagtcag
cagttgccgcagtgcagcatggccgctaattttaccccgcccatgcagctggccgagatc
cccgagacgggcggcgccaacgtcggcctctacgagcggatggggcagggcgaattcggg
ccgggccattacccgcagccctcggccaccttcagcctcgccaaactgcagcagttgacc
aatacgcttatcgatcattcgttgccttacagccattccgctgctgtaacttcctatgca
aacagtgcctctctgcccacccctctaagtaacgcgggactcgttcagctctctcaatct
ccgcatcccgtccccgggggggcccaagcacaagccaccatgaccccgccccccaacctg
actcctccgccgatgaatctgcctcccccgctcctgcagcgcaacatggccgcgtccaac
atcggactctcccacacccaaagactgcagactcagatcgccggcaagggccacgtgtcc
atgaggaccaagtcggcggccctgcccccggccgccgccgccgccgccgccgccgccgcc
gccgcccaccagtcccagatctacgggcgagcttcccaggccgtcgccatgcagggtccg
gcacggactttaaccatgcagcgtggcatgaacatgagcgtcaacctcatgccggccccg
gcttacaacgtcaattcggtgaacgtgaacatgaacacgctcaatgccatgaacgggtac
agcatgccgcagccgatgatgaacagcggataccacggtaatcacggatacatgaatcag
actccccagtaccccatgcagatgcagatgggcatgatgggaacccagccatacgcacag
cagccgatgcaggccaccccccacagcaacatgatgtacactccgcccgcccatcacggc
tacatgaacaccggcatgcccaaacagtcccttaacggctcctacatgaggaggtag

DBGET integrated database retrieval system