KEGG   Ornithorhynchus anatinus (platypus): 100075055Help
Entry
100075055         CDS       T01045                                 

Gene name
LAMB2, LAMC1
Definition
laminin, beta 2 (laminin S)
Orthology
K06243  
laminin, beta 2
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100075055 (LAMB2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100075055 (LAMB2)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    100075055 (LAMB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100075055 (LAMB2)
   05222 Small cell lung cancer
    100075055 (LAMB2)
  Infectious diseases
   05146 Amoebiasis
    100075055 (LAMB2)
   05145 Toxoplasmosis
    100075055 (LAMB2)
Cell adhesion molecules and their ligands [BR:oaa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      100075055 (LAMB2)
   VLA-6
      100075055 (LAMB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1455 aa AA seqDB search
MEMGSEGAKGKELLLLLLLLLLLPFECECNPLKRRECHFDMAVFLASGNMSGGVCDGCQH
NTMGQHCQLCRPFYYRDPSRGLRDPNVCRACDCDPSGSLNGGLCDSHDDPALGLLAGQCR
CKDHVAGPRCQSCRDGFFGLSADNSQGCRRCRCDPRGTVSGGPPCDPVSGDCFCKRLVTG
PSCDQCLGAYDNQCARETGQCHCRNHMIGRRCNQVQPGHYRPYLDHYTYEAEDAQRDWDV
KVVERTALLGHEPSWTGTGFVQLQEGNTLKFSVDNLPFSMDYSLLLRYEPQAPDQWAEVT
VLVQRPGPVAVSSPCGNTIPEDDRLRGMLPPGVRHVVLPQRICLEQGLKYTIQLELTHGG
TRLGAPELGLLLDSLVLVPYYSMLEMFSAGDADSIERRTTFERYRCHEESLTPAKGSPAE
ACAPLLISLAALLHDGALPCQCDPQGSLSSECNPHGGQCQCKANVVGRRCDRCAVGTYGF
GPSGCRACQCNPEGTLSSLCDSVSGQCPCRPGAFGSRCDHCQPGHWGFPRCRPCHCNGHA
EECDQRTGACQACRDHTAGDRCDRCVAGFYGNPVLTSGGHCRPCPCPEGPGSRRHFAASC
HQDGHSHQVICHCQPGHTGPRCEECAPGHYGNPSQAGGRCQPCQCSNNIDPTDPEACDRR
TGQCQRCLYHSEGPHCAYCRPGYYGQAAHHSCRRCSCNFLGTERSQCPSQEECHCDQSSG
QCPCLPNIQGQNCDRCAPNFWNLASGQGCQPCDCHPSHSVSPSCNEFTGQCHCRAGFGGR
ACTDCQENHWGDPSQQCRACDCDPRGIETLQCHRTTGHCNCRPGVSGVRCDQCARGFSGT
FPICHPCHQCFGDWDRVVQDLATRTRHLGQRAQELQQSGAIGAFERNFRLLEEKLGTVQG
IVSARNTTATAITQLMKITEELRSGIGEATERLNQLERELTVAQDENFNSNHALSGLERD
GRALNLTLNQLGRQLDLLKNSNFLGAYDSILQSYTESVEAERHANASALAVPSPISDSAG
TRRRVEKLMDSRRDSFNRKNVANQKALENLSARANALSLTGINELVCGAPGDAPCATSPC
GGAGCRDEDGQRRCGGLNCQGAAATADNALGRARHTQEELRRTLGDADELVNKVAEAKLQ
AGAARLRAQAALDKANRTRGQVERSNQELRELIQNIKDFLSQEGADPGSIEAVANRVLEL
SIPASSSQISHLAGEIAQRVRSLAHVDAILERTAGDVRQAEQLLHDAQRARSHAQGEKQK
AEMVQEALEEAKRAQSAAEGAIRSATDDTQHTERTLDTVAAKAAGAERELNAAAKRAEQL
DAQLDALKLKRAGNSLAATQAEETASNAQGRANEAEKLLKDQLGDRFQTVQELAERKAQG
VLQAKQRAERLRDEARGLLTDAQDKLRRLHELEGTYEENERELEDKAAQLDGLEAKMKGI
LDSINQQIQIYNTCQ
NT seq 4368 nt NT seq  +upstreamnt  +downstreamnt
atggagatgggcagtgagggagctaagggcaaagagctgctgctgctgctgctgctgctg
ctgctgctgccttttgagtgcgagtgtaacccccttaaaaggagggagtgccacttcgac
atggctgtgttcctggcctcgggcaacatgagtggaggcgtgtgcgatggctgccagcac
aacaccatgggacagcactgccagctctgccgtcccttctactaccgtgaccccagcagg
ggtctgcgtgatcccaatgtgtgccgagcctgtgactgtgacccgtcgggctccctgaac
ggtggcctctgtgactcccatgacgatcctgccctgggactcctcgcgggccagtgtcgc
tgcaaggatcatgtggcagggcctcgctgtcagagctgccgggatggtttctttggcctg
agcgctgacaactcccagggctgtcggcggtgtcgctgtgatccccgggggacagtgtct
ggggggcctccgtgtgatcctgtgagcggggactgcttctgtaagcgtctggtcacgggt
cccagctgtgaccaatgcctgggggcctacgacaaccagtgtgcaagagagacagggcag
tgccattgccgcaaccacatgataggaagacgctgcaaccaagtacaacctgggcactac
cggccgtatctagaccactacacttacgaggctgaggatgcccagcgggactgggatgtc
aaggtggtggaacggacggcgctccttggccacgagccttcctggactggcactggcttt
gtgcagctccaggagggcaataccctcaagttctccgtggacaacctccccttctccatg
gactatagtctgctccttcgctatgagccacaggccccggatcaatgggcagaagtgaca
gtgttggtgcaacgcccgggcccagtggccgtcagcagcccctgtggcaacaccatccct
gaggatgaccggctacgtgggatgctccctcctggagtcaggcatgtggtgctgcctcag
cgcatttgcctggagcaaggcctcaagtacacgatccagcttgagctgacccatggaggt
acccgtctcggtgcccctgaactcggcttgttgcttgactcgcttgtgctggtgccctac
tactcgatgctggagatgttcagtgcgggagacgcagactccatcgagcgccgcaccacc
tttgagcggtaccgctgccatgaggagagtttgaccccggccaagggatccccagcggag
gcctgtgccccactgctcatcagcctggcggctctgctgcatgatggggcgctgccctgc
cagtgtgacccccagggctctctcagctccgagtgcaacccccatggcggccagtgccag
tgcaaagctaacgtcgtggggcggcgctgcgaccgttgtgccgtggggacttatggcttt
ggcccctccggctgcagagcatgtcagtgcaaccccgaaggcaccctgagcagcctgtgt
gacagtgtcagtggccagtgcccctgccggcctggtgccttcggatcgcgctgcgaccac
tgccagccgggtcactggggcttcccccgctgtcggccctgccactgtaacgggcatgcc
gaagaatgtgaccagcggacaggggcctgccaggcctgccgagatcacactgcaggggac
cgctgtgacaggtgtgtggctggtttctatggaaacccagtgctgacctcaggtgggcac
tgccgcccctgcccctgccctgagggcccaggcagtcgacgccactttgctgcctcctgc
catcaagatgggcactcccaccaggttatttgccactgtcagcctgggcatacaggaccc
cgctgtgaggaatgtgctcctgggcactatggtaacccgtcccaggctgggggccgctgc
caaccctgccagtgcagcaacaacatagaccctaccgaccccgaggcctgtgaccggcgc
accggacagtgccagcgctgcttgtaccattcagagggaccccactgtgcctactgccgt
cctggctactacggacaggctgctcaccacagctgccggaggtgcagctgtaacttcctg
ggcaccgagcgcagtcagtgcccctctcaagaagagtgccactgtgaccagagcagcggg
cagtgcccgtgtctaccaaatatccaaggccagaactgtgaccgctgtgcccctaacttc
tggaacttggccagcgggcaaggttgccagccctgtgactgccaccccagccactcggtc
agcccttcctgcaatgagttcacaggacagtgccactgccgggcaggatttgggggccgg
gcctgcactgattgccaggagaatcactggggagatcctagccagcagtgccgggcctgc
gattgtgatccccgaggcatcgagaccctccagtgccaccgcaccacgggtcactgcaac
tgccgtccgggagtatctggtgtgcgctgcgaccagtgtgcccggggattctcgggcacc
tttcccatctgccatccttgccaccagtgtttcggggactgggaccgagtggtacaggat
ctggccacccgcacccggcacctgggacagcgagcacaggagctgcagcagtcaggagcc
ataggggcttttgaaaggaacttccggctgttggaagagaaactgggcaccgtgcagggc
attgtcagtgctcgaaacaccaccgccacagccatcacccagctcatgaagatcactgag
gaactgcggagcgggatcggggaggccacagaacggctgaaccagctggaacgggaactg
accgtggctcaggatgagaacttcaactccaaccacgcactaagtgggctggagagggat
ggccgggccctcaacctcaccctgaaccagctgggccgccagctggacctcctgaagaat
tccaacttcctgggtgcctacgatagcattctacagtcctacaccgaatcggtagaggcc
gagcgccacgccaacgcctccgccctggcggtgcccagccccatcagtgactctgcgggc
acccgccgtcgggtggagaagctgatggacagccggcgggacagtttcaaccgcaagaat
gtcgccaaccagaaggccctggagaatctctcagcccgggccaatgccctcagcttgaca
ggcatcaatgagctggtgtgtggggccccaggagatgccccctgcgccacgagcccctgc
gggggagctggctgccgcgatgaggatggacagcggcggtgcgggggcctcaactgccag
ggagcagcagccaccgcagataacgccctgggccgggcccggcacactcaggaagagctg
cggcgaactctgggtgacgccgacgagctcgtgaacaaggttgctgaggccaagctgcag
gctggtgccgcacggctgcgagcacaggcggccctggacaaagccaacaggacccggggt
caggtcgagcgctccaatcaggaattgagggagctcatccagaacatcaaggacttccta
agccaggagggggcggacccagggagcatcgaggctgtggccaaccgggttctggagctg
tccattccggcctcgtcctcccagatcagccacctggcaggagagatcgcccagcgggtg
cgcagcctggctcacgtggatgccatcctggaacgcacggccggggacgtgcgccaagcc
gagcaactcctgcatgatgctcagcgggcacggagtcatgcccagggggagaaacagaaa
gcagagatggtgcaggaagccctggaagaggcaaagcgagcacagagcgcagccgagggg
gccatccgcagtgctactgatgacacccagcacactgaacggacactagacacggtggcg
gccaaggcggctggggctgagcgagagttgaatgctgcagccaagcgtgcagagcagctg
gatgcccagttagatgcccttaagctgaaaagggccggaaatagcctggcagctacccag
gcagaagagacggccagcaatgcccagggccgtgccaatgaggcagaaaagctgctgaaa
gaccagctgggagaccgcttccagaccgtgcaggaactggcagagcggaaggctcaaggt
gtcttgcaggccaagcaaagagccgagaggctgagagatgaggcaagggggctcctgaca
gatgcacaggacaagctgaggcgcctgcatgagctggaggggacatacgaggagaatgag
cgtgagctggaggacaaggctgctcagctggacgggttggaggcaaagatgaagggaatt
ctcgactccatcaatcagcagattcagatctataacacctgccagtga

DBGET integrated database retrieval system