KEGG   Ornithorhynchus anatinus (platypus): 100075164Help
Entry
100075164         CDS       T01045                                 

Gene name
STAMBPL1
Definition
STAM binding protein-like 1
Orthology
K11867  
AMSH-like protease [EC:3.1.2.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100075164 (STAMBPL1)
Peptidases [BR:oaa01002]
 Metallo Peptidases
  Family M67
   100075164 (STAMBPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 352 aa AA seqDB search
MDQPFTVNSLKKLVALPDHTDVSLSPEERLRALRKLGCNITINDDITPRRYFRSGVEMER
MASVYLEEGNLENAFVLYNKFITLFVEKLPGHRDYQQCAVPEKQDIMKKLKEIAFPRTDE
LKKELLKKYNVEYQEYWQGKNEYKAEYLKKIERQRLIEAEKKRIAQMRQQQLETEQFQFF
EDQLKKQELARDQIKNQETLGKPEPKDGNALSRLSTYRNDSLLNVLSDQANKSDAANQVD
QSPPINRALKPAATLSAVQNQIIEGLRCVVLPRDLCHKFLMLADSNTVRGIETCGILCGK
LTHNEFTITHVIVPKQSAGPDYCDMENVEELFNVQDQHGLLTLGWIHVTLVL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggaccagccttttaccgtgaattcactgaaaaagctggtggcactgcctgatcacacc
gatgtgtccttgagcccagaagagcggttgcgggccttgcgcaagcttggttgtaatatc
acgatcaacgatgacatcactccgcgccgctatttccgatccggggtggagatggagcga
atggcgtctgtgtatctggaggaaggaaacctggaaaatgcctttgtcctctataataaa
tttataaccttgtttgtagaaaagctgcccggccatcgagattaccagcaatgtgccgtc
ccagagaaacaagacatcatgaagaaactgaaggagattgcatttccaaggacagatgaa
ttgaaaaaggagcttttaaagaaatataatgtagaatatcaagaatattggcaaggcaaa
aatgaatacaaagctgaatacctaaagaaaatcgagcggcagcgactgatagaggcggaa
aagaagagaattgcccagatgagacagcagcagcttgaaactgagcagtttcagtttttc
gaagatcagctcaagaaacaggaattagcccgagatcagataaagaatcaggaaaccctg
ggcaagccagagccgaaggatgggaatgctctgtctcgtctttctacgtatcggaacgac
tccttgttgaatgtactttcggatcaagccaataaaagtgatgcggctaatcaagtcgac
cagtctcctcccattaacagagctttaaagccagctgctacactgagcgctgtgcagaat
caaatcatcgaaggactacgatgcgtagttttacctagagatctttgccacaagtttctg
atgctggccgactcaaatacagtgcgaggaatcgagacctgtggaattctctgtgggaaa
ctgacacataacgaatttactattacccacgtgatagtgccaaaacagtctgcaggacca
gactactgtgacatggagaatgtagaggagttattcaatgttcaggatcagcatggtctt
ctcaccctcggctggatccatgttacattggttttgtaa

DBGET integrated database retrieval system