KEGG   Ornithorhynchus anatinus (platypus): 100075215Help
Entry
100075215         CDS       T01045                                 

Definition
histo-blood group ABO system transferase 2-like
Orthology
K00709  
histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100075215
Enzymes [BR:oaa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.37  fucosylgalactoside 3-alpha-galactosyltransferase
     100075215
    2.4.1.40  glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase
     100075215
Glycosyltransferases [BR:oaa01003]
 Glycan extension
  ABO blood group
   100075215
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 352 aa AA seqDB search
MQLIQAKGKLSCCSRRWLGVILLMAIFLGYFSQGFLDLKGNHLDLPSEQPSRAAHQNDLP
VVKLMRLIYPKPQVLHPPRNDVLVITPWLAPVVWEGTFNIDIINEQFRQRNITVGLTVFA
IKKYVVFLKLFLETAEKHFMMGHKVNYYVYTDRPADVPAVPLREGRKMVVLEVQNYARWQ
DVSMHRMEMISYFAQQRFHREVDYLVCADVDMKFSDHVGVEILSPLFGTLHPGFYGAERR
SFTYERRPLSQAYIPLDEGDFYYMGAFFGGTVSEVYKLTKECHQAMMMDKSNRIEAVWHD
ESHLNKYLLYHKPTKVLSPEYMWDEQLLGRPAILQKLRYVAVPKNHAEIRNR
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttatccaggcaaaagggaagctgagctgctgctccagacgctggctgggagtg
atcctgctgatggccatcttccttggctactttagccagggtttcttggacctaaaaggc
aatcatctggatcttccatcagagcagccaagcagagctgcacaccagaatgacctgccg
gttgtgaagttaatgaggttgatttaccccaaaccacaagttctacatcctccgagaaat
gacgtcctggtaattactccctggcttgctccagttgtctgggaagggacttttaacatt
gatatcataaatgagcaattcaggcaaaggaacatcaccgtgggactgacagtgtttgcc
atcaaaaagtatgtggtcttcctgaagttgttcctggaaaccgcagagaagcacttcatg
atggggcacaaggtgaattattacgtctacacggaccgaccagctgacgtccccgccgtc
cccctccgagaaggaaggaagatggtggtgctggaagtccagaactacgcccgttggcag
gacgtctccatgcaccgcatggagatgatcagctacttcgcccagcaacgcttccaccgg
gaagtagactatctcgtgtgtgctgacgtagatatgaagttcagcgaccacgtcggggtg
gagattctgagccctctgttcggcactctccacccgggcttctacggggccgaacggaga
tccttcacctacgagcggcggcccttgtctcaagcctacattcccctggacgagggggac
ttctactacatgggggccttttttggagggacagtgagcgaggtgtacaagctcaccaag
gagtgtcaccaagccatgatgatggacaagagcaatcgcattgaagcagtttggcacgat
gagagtcacctaaacaaatatctgctttaccataaaccaaccaaagttctttctccagaa
tacatgtgggatgagcaacttctgggaaggccggccatccttcagaaattgaggtatgtg
gccgtgcctaagaaccatgccgaaattcgaaacagatga

DBGET integrated database retrieval system