KEGG   Ornithorhynchus anatinus (platypus): 100075452Help
Entry
100075452         CDS       T01045                                 

Gene name
NLK
Definition
nemo-like kinase
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100075452 (NLK)
   04310 Wnt signaling pathway
    100075452 (NLK)
   04068 FoxO signaling pathway
    100075452 (NLK)
 Cellular Processes
  Cell communication
   04520 Adherens junction
    100075452 (NLK)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100075452 (NLK)
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   100075452 (NLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 408 aa AA seqDB search
MKTASNDLKKIFVEFETEPFLFFFFLFPFTCFSRSVTDPRDGKRVALKKMPNVFQNLVSC
KRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSD
HVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQ
EVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGT
PSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAK
DALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPITNPKFDDTFEKNLSSVRQVKE
IIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagcatcgaatgacttaaaaaagatatttgttgagtttgaaactgagcctttt
ctttttttttttttcctttttcccttcacttgcttctctaggtcagtaacagatccaaga
gatggaaagagagttgccctcaaaaagatgcccaacgtcttccagaatctggtctcttgc
aaaagggtcttccgagaattgaagatgttgtgtttttttaagcatgataacgtgctctct
gcccttgacattctccagcctccacacattgactattttgaagaaatatatgttgtcaca
gaattgatgcagagtgacctccataaaattatcgtctctcctcagccactcagctcagat
cacgtcaaagtttttctttatcagatcttaagaggtttaaagtacctccattcagctggc
attttacatcgagacattaagccagggaatcttcttgtgaacagcaactgtgttcttaag
atttgcgattttggattggccagagtcgaagaattggatgaatcccgtcacatgactcag
gaagttgtcactcagtattatcgggctccggaaatcctgatgggcagccgtcattatagc
aatgctatagacatctggtctgtaggctgcatctttgcagagctcctaggtcgaagaata
ctgtttcaggcacagagtcccattcaacagttggatttgatcacagatctgctgggcaca
ccgtcgctggaagcaatgaggacggcttgcgaaggtgctaaggcacacatactcaggggt
cctcataaacagccatctcttcctgtcctgtatacactgtctagccaagctacacatgaa
gctgttcatctcctctgcaggatgttggtctttgatccatccaaaagaatatccgctaag
gatgccttagcccacccgtacctggacgaagggcgactgcgataccacacgtgtatgtgt
aaatgctgtttttcaacctctactggaagagtttataccagtgactttgaacccatcacc
aatcccaaatttgatgacacttttgaaaagaatctcagttctgttcgacaggtcaaagaa
attattcaccagttcattttggaacagcagaaaggaaacagagtgcctctctgcatcaac
cctcagtctgctgcttttaagagctttattagttccactgttgctcaaccgtctgagatg
cccccatctcccctggtttgggaataa

DBGET integrated database retrieval system