KEGG   Ornithorhynchus anatinus (platypus): 100075531Help
Entry
100075531         CDS       T01045                                 

Gene name
PRKG2
Definition
(RefSeq) cGMP-dependent protein kinase 2
  KO
K19477  cGMP-dependent protein kinase 2 [EC:2.7.11.12]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa04022  cGMP-PKG signaling pathway
oaa04540  Gap junction
oaa04611  Platelet activation
oaa04713  Circadian entrainment
oaa04714  Thermogenesis
oaa04730  Long-term depression
oaa04740  Olfactory transduction
oaa04923  Regulation of lipolysis in adipocytes
oaa04924  Renin secretion
oaa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    100075531 (PRKG2)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    100075531 (PRKG2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100075531 (PRKG2)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100075531 (PRKG2)
   04924 Renin secretion
    100075531 (PRKG2)
  Digestive system
   04970 Salivary secretion
    100075531 (PRKG2)
  Nervous system
   04730 Long-term depression
    100075531 (PRKG2)
  Sensory system
   04740 Olfactory transduction
    100075531 (PRKG2)
  Environmental adaptation
   04713 Circadian entrainment
    100075531 (PRKG2)
   04714 Thermogenesis
    100075531 (PRKG2)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100075531 (PRKG2)
Protein kinases [BR:oaa01001]
 Serine/threonine kinases: AGC group
  PKG family
   100075531 (PRKG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 LZ_Tnp_IS481 APH
Motif
Other DBs
NCBI-GeneID: 100075531
NCBI-ProteinID: XP_001507010
Position
Un
AA seq 282 aa AA seqDB search
MKCVKKKHIVDMKQQEHIYSEKRILEEASSPFVVKLYRTFKDNKYVYMLLEACLGGELWS
ILRDRGSFDEPTSKFCVACVTEALDYLHQMGVIYRDLKPENLILDSAGYLKLVDFGFAKK
IGSGQKTWTFCGTPEYVAPEVILNKGHDCSVDFWSLGVLVYELLAGNPPFCGTDQMMTYN
LILKGIEKMDFPKNISRRSEDLIRRLCKQSPTERLGNLKNGISGIKKHRWLNSFNWEGLK
ARSLRSPLKRELSGPTDHSYFDSYPPDKGTPPDELSGWDRDF
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcgtgaagaagaagcacatcgtggacatgaagcagcaggagcacatctactcg
gaaaagcggattctggaagaggcgagctctccgtttgttgtgaaattgtatcggaccttc
aaggacaataagtacgtgtacatgcttctggaagcctgcttgggtggagagctttggagt
atcctcagggacagaggtagctttgatgaacccacctccaagttctgtgtcgcctgcgtg
acagaggcgttggattatctgcatcagatgggagttatctacagggatctgaaaccagag
aatttgattttggacagcgcggggtatctgaagttggtggattttggatttgccaagaag
atcggatctggacaaaaaacatggacattctgtgggactcccgaatacgtggctcctgag
gtgatcctcaacaaaggccacgactgcagtgtggacttctggtccctgggcgtcctggtg
tatgaacttctcgctggcaaccccccattctgtgggactgaccagatgatgacctacaat
ttgattctcaaagggatcgaaaaaatggattttcctaaaaatattagccgtcgctcggaa
gatttgatccgcaggctttgcaaacagagccccacagaaaggctggggaacctgaagaat
ggaatttctggcattaaaaagcacaggtggctgaatagttttaactgggaaggactcaag
gcaaggagccttcggtcgcctttgaagagggagctcagcggacccacggatcacagctac
ttcgacagctaccctcctgacaagggcactcctcccgatgaactttccggctgggatcgt
gacttctga

DBGET integrated database retrieval system