KEGG   Ornithorhynchus anatinus (platypus): 100075575Help
Entry
100075575         CDS       T01045                                 

Gene name
ALAD
Definition
aminolevulinate dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100075575 (ALAD)
Enzymes [BR:oaa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     100075575 (ALAD)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100075575 (ALAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 330 aa AA seqDB search
MQPESVLHSGYFHPLLRSWQAAATTFDASNLIYPVFVTDSPDAVQPIASLPGVARYGVKK
LEEMLRPLVAQGLRCVLIFGVPTKVTKDERGSAADAEDTPAIQAIRTLRAAFPELLVACD
VCLCPYTSHGHCGLLRKDGSIRAEDSSRRLAEVALAYAKAGCQVVAPSDMMDGRIAAIKE
ALIANGLGNQVSVLSYSAKFASCFYGPFRDAAQSSPAFGDRRCYQLPPGARGLALRAVDR
DVREGADLLMVKPGMPYLDIVREVKDKHPALPLAVYHVSGEFAMLWHGAQAKAFDLKAAV
MEAMTSFRRAGADIIITYYTPQLLHWLKEA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccgagtccgtgcttcacagcggttacttccacccgctgctgcgcagctggcag
gcagctgccaccacctttgatgcctccaacctcatctaccctgtcttcgtcactgacagc
cctgatgccgtgcaaccgatcgccagcctccctggagtggccaggtatggggtgaaaaag
ctggaagagatgctgcggcccctggtggcccagggcttgaggtgcgtcttgatctttggg
gtccctaccaaggtcaccaaggatgagcggggttcagcagcagacgcagaggacactcca
gctatccaggccatccggaccctgcgggcagccttccctgagctgttggtggcctgtgac
gtatgcttgtgcccctacacctcccatggtcattgtgggctcttgaggaaggacggctcc
atccgcgctgaagacagcagccggcggctggcagaggtggcactggcttatgccaaggca
ggctgccaggtggttgctccatcagatatgatggatgggcgcattgctgctatcaaggag
gctctgattgccaatgggcttggcaaccaggtgtctgtgctgagctacagtgccaaattc
gcctcctgcttctatggccccttcagggatgcagcccaatccagcccagcttttggagac
agacgctgctaccagctgcccccaggagcccgcggtctggccctgcgagctgttgaccgg
gatgtgcgggagggggcagatttgctgatggtgaagcctgggatgccctacctggacatc
gtgcgggaggtgaaggataagcaccctgcgctcccattagctgtgtatcacgtgtccggg
gagtttgccatgctgtggcacggtgcccaggccaaggcctttgacctcaaggctgcagtc
atggaggccatgacatctttccgcagagcaggtgccgatatcatcatcacctactacacg
ccccagctcctgcactggctcaaggaggcgtga

DBGET integrated database retrieval system