KEGG   Ornithorhynchus anatinus (platypus): 100075704Help
Entry
100075704         CDS       T01045                                 

Definition
retinoic acid receptor beta-like
Orthology
K08528  
retinoic acid receptor beta
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Pathways in cancer
Small cell lung cancer
Non-small cell lung cancer
Class
Human Diseases; Cancers; Pathways in cancer [PATH:oaa05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:oaa05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:oaa05223]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 527 aa AA seqDB search
MTTSSHTCPVPAVNGHMNHYPTAPYPLLFPPVIGGLPLPSLHGLHGHPPTSGCSTPSPAT
IETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
IYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKELKSPLKAKVLVLLSFGLMLEYYSL
KSATDNCNDFILAITSSEGEKREFTCAFFRSLTEQQNSGLRCGNQNFTRYSRCSCNHKEK
QNHALDFSFQILANGRHLKLCYDKCLAVRTEHCTKRLGEYSTNSSADHRVRLDLGLWDKF
SELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSD
GLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPIKV
DKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPP
LIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVDNSSVSQSPLVQ
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccagtagccacacatgtccagtaccagccgtgaacggacatatgaatcattat
cccactgctccttatccattactcttccctccggtcattggcggactcccactcccgtcc
ctccatggacttcacggccacccacccaccagcggctgcagcaccccatcacctgcaacc
atcgaaacccagagtaccagttctgaggaactggttccaagccccccttctccacttcct
ccacctcgtgtttacaagccgtgtttcgtctgccaggacaagtcatccgggtatcactat
ggagtcagtgcttgtgaaggatgcaaggggtttttccgcagaagtattcagaagaacatg
atttatacttgtcacagagataagaactgtgttattaataaagtcacaaggaatcgttgc
cagtactgcagactacagaagtgctttgaagtgggaatgtccaaagaattgaagagcccc
ctcaaagctaaagttttggtactgttaagttttggactaatgttggagtactactcctta
aagtcagcaacagataactgcaatgacttcattttagccattacatcttctgagggagaa
aaaagggaatttacttgtgctttcttcaggtccctgactgagcagcagaattctggattg
aggtgtggcaaccagaacttcacccgatattccaggtgctcctgcaatcacaaagaaaag
caaaaccatgcactggatttcagtttccagatccttgctaatggacgacacctaaaactc
tgctatgataaatgcctggcagttagaacagagcactgtactaagcgcttgggagagtac
agtacaaattctagtgcagaccatcgggtccggctggatctggggctctgggacaaattc
agtgaactggcgaccaagtgcatcatcaaaattgtggaatttgcaaagcgcctgcccggc
ttcaccggcctgaccatcgcagaccagatcaccctcctcaaagccgcctgtctggacatc
ttgattcttagaatttgcacaagatacacaccagagcaagacaccatgacattttcagat
ggccttaccctgaaccgaactcagatgcacaacgctggatttggtcctttaactgacctt
gtgttcacctttgccaatcagctcctgcctttggaaatggatgacacagagactggcctt
cttagtgccatctgcttaatctgtggagaccgccaggaccttgaggaacccattaaagtg
gataagttacaagaaccattgcttgaagctctgaaaatatacattaggaagagacgaccc
agcaagcctcatatgtttccaaagatcttaatgaaaatcacagatctccgcagcatcagt
gcaaaaggtgcagaacgtgtgattacattgaaaatggaaattcctggatcaatgccaccc
ctcattcaggaaatgctggagaattctgaaggacatgaaccattaacaccaagttcaagt
ggaaatacagcagagcacagtcctagcatctcacctagctcagtggataacagcagtgtc
agtcaatccccgctggtgcaataa

DBGET integrated database retrieval system