KEGG   Ornithorhynchus anatinus (platypus): 100075723Help
Entry
100075723         CDS       T01045                                 

Definition
acetyl-coenzyme A synthetase 2-like, mitochondrial-like
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:oaa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:oaa00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:oaa00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:oaa00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 509 aa AA seqDB search
MAEQAIPVPRSLGLLLLGLADRLPGIWWHWMNCLDRHVQRSPDKVALIWERDEPGTEVRV
TYRELLDITCRLANILKKHGVSRGDRVALYMPVSPLAVAAMLACARVGAVHTVIFAGFSA
ESLAGRINDAKCKVVITANQGLRGGRVIELKKIVDEAVKNCPSVKCVLVVQRTDNKVPMG
NLDILLEDEMTQASAVCPPESMDSEDMLFLLYTSGSTGSPKGLVHTQAGYLLYAALTHKH
VFDYREGDVFGCVADIGWITGHTYVVYGPLCNGATTVLFESTPIYPNAGRYWETVQRLKI
NQFYGAPTAVRLLLKYGDDWVKKYDLSSLRTLGSVGEPINQEAWDWLYHVVGDGRCTLVD
TWWQTETGGICIAPRPSEEGAEIRPAMAMRPFFGISPTLIDEKGKVMEGGNISGALCISQ
PWPGMARTIYGDHQRFIEAYFNAYPGHYFTGDGAFRTSEGYYQITGRMDDVINISGHRLG
TAEVEDAMANHPSVPESAVIGYPHDVKGE
NT seq 1528 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcaggcaattccagtcccgagatccctgggcctgctgctgttgggtcttgct
gacaggctgcctggcatctggtggcactggatgaactgcttagatcggcatgtccaaagg
tccccggacaaagtggctttgatctgggagagagatgaacctggaaccgaagtgagagtc
acatacagggaacttctggacatcacgtgccgcctcgccaatattctgaaaaaacatggg
gtgagccgtggggacagagtggccctgtacatgcctgtgtctcctttggcggtggcagcc
atgctggcttgtgcccgggtcggggctgtgcacacggtgatctttgctggattcagcgcc
gagtctttggctggacgaatcaatgatgcaaaatgcaaagtggtcatcactgccaaccag
ggcctgagaggaggccgagtcattgagctgaagaagatagtggatgaagccgtaaaaaat
tgcccttcagtcaagtgtgtcctggtggttcagaggacagacaacaaagtgcccatgggg
aatctggacatcctcctggaagatgagatgacccaagcaagtgcagtgtgtcctcccgag
tccatggacagtgaagacatgctgtttctgctttacacttcagggagcacaggctcacca
aaggggctggtccacactcaagctggatacttgctttatgctgctctgacccacaagcat
gtctttgactaccgggaaggggatgtgtttggctgtgtggcagatatcggttggatcacg
ggacacacttacgtggtatatgggccactctgcaatggagccaccacagtcctgtttgag
agcactccaatatacccaaatgcaggtcgatactgggaaactgtgcagaggttaaaaatt
aaccagttttacggtgctcccactgctgtgcgactgctactgaaatatggagatgattgg
gtgaagaagtatgatctgtcttccttaagaactttgggatcagtcggagagccaattaac
caggaggcttgggactggctgtaccacgtggtgggagatggccggtgcacactggtggac
acctggtggcaaacagaaacagggggaatttgcatcgccccgcgaccctcagaggagggt
gccgagatccgtcctgctatggccatgaggcccttcttcgggatctccccgaccttgata
gatgagaagggaaaagtcatggaaggtgggaacatctctggtgccctgtgcatctcccag
ccttggcctggcatggcaagaaccatctatggagaccatcagagattcatcgaagcatac
ttcaatgcctacccaggccattacttcactggggatggtgccttcaggacctccgagggc
tattaccagatcaccggaaggatggacgatgtcatcaacatcagcggccatcgcttgggg
acggcagaggttgaagatgccatggccaaccacccatctgtgccagaatcagcagtgatt
ggttatccccatgacgtcaagggagaag

DBGET integrated database retrieval system