KEGG   Ornithorhynchus anatinus (platypus): 100075856Help
Entry
100075856         CDS       T01045                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100075856
Enzymes [BR:oaa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     100075856
Glycosyltransferases [BR:oaa01003]
 Glycan extension
  Type 3 chain
   100075856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 257 aa AA seqDB search
DRGEGAGARGSSNRRVCRLPPPPRLSPVPPRDEDTAVAADLYEKVKVLCWVMTGPQNLEK
KAKHVKATWARRCNRVLFMSSEADADFPAVGLETKEGRDQLYWKTIRAFQYVHDRHLAQA
DWFLKADDDTYVVLDNLRRLLARHDPERPLYFGRRFKPYVKQVYMSGGAGYVLSREALRR
FVDAFQRRFPGPGCCSDLAISFHYVDPTTMYQLEYLTYHLRPYGYRYRYQPEPPEPPEKQ
TGRAGGNEASKTSVGSP
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gatcgaggggaaggggcgggcgcaagagggtcttctaaccggcgagtctgtcgtctcccc
cctcctccccgtctctcccccgtcccgccccgagacgaggacacggcggtggccgccgac
ctgtacgagaaggtgaaggtcctctgctgggtgatgaccggcccgcagaacctggagaag
aaggccaagcacgtcaaggccacctgggcccggcgctgcaaccgggtgctgttcatgagc
tcggaggcggacgcggacttcccggccgtgggcctggagaccaaagagggccgcgaccag
ctgtactggaagaccatccgggccttccagtacgtccacgaccgccacctggcccaggcg
gactggttcctcaaggcggacgacgacacctacgtggtgctggacaacctgcggcggctg
ctggcccggcacgaccccgagcggcccctctacttcggccgccgcttcaagccctacgtg
aagcaggtctacatgagcgggggcgctggctacgtgctgagccgcgaagccctgaggcgt
ttcgtggacgccttccaaagacggttcccgggtcccgggtgctgttcggatctggccatc
tcgttccactacgtcgaccccaccacgatgtaccagctggagtatctgacctaccacctc
cgaccctacggctacaggtacagataccagcccgagccccccgagccccccgagaagcag
accggccgagccggcggcaacgaagcctccaagaccagcgtcggcagcccctga

DBGET integrated database retrieval system