KEGG   Ornithorhynchus anatinus (platypus): 100075896Help
Entry
100075896         CDS       T01045                                 

Gene name
PAK2
Definition
p21 protein (Cdc42/Rac)-activated kinase 2
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100075896 (PAK2)
   04010 MAPK signaling pathway
    100075896 (PAK2)
   04012 ErbB signaling pathway
    100075896 (PAK2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100075896 (PAK2)
  Cell communication
   04510 Focal adhesion
    100075896 (PAK2)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    100075896 (PAK2)
  Development
   04360 Axon guidance
    100075896 (PAK2)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    100075896 (PAK2)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100075896 (PAK2)
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   100075896 (PAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 388 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSTIFSAGGKDPLSANHSLKPLPSVPEERKPRHKIISIFSGN
EKGNKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPMLNAKGSEPSTVVTEDDDDDDDEEA
PPPVIAPRPDHTKSIYTRSVIDPIPAPAGDSNVDGAAKSSDKQKKKTKMTDEEIMEKLRT
IVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVM
KELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEF
LHANQVIHRDIKSDNVLLGMEGSVKLSE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggagagctggaagacaaacccccggcaccccctgtccgaatgagcagc
accatctttagcgctgggggcaaagaccccttgtcagcaaaccacagcctgaagcctctg
ccctccgttccagaggagagaaaacctcggcacaaaatcatctccattttctcaggcaat
gagaagggaaataagaaaaaggagaaggagcggccagaaatctctcccccgtcggatttt
gagcacaccatccacgtgggctttgatgccgttaccggagaattcactggaatgccagaa
caatgggctcggttgcttcagacttccaatatcactaaactcgagcagaagaagaatccc
caagctgtgctagatgttctgaagttctacgactccaacacagtgaagcagaaatatctg
agcttcactcctccggaaaaagatgggttcccttcaggaacgcccatgttgaacgccaaa
ggatcagagccctcgaccgtggtgacggaagacgacgacgacgatgacgatgaagaagcc
cctcctccagtcatcgctcccagaccggatcacacaaaatcgatttacacccgctctgtg
atcgaccccattcccgcaccagccggcgactcgaacgtcgatggcgccgccaagtcttcg
gacaaacagaaaaagaagaccaagatgacggacgaagagatcatggagaaactaagaact
atagtcagcataggtgaccccaagaaaaaatacaccagatatgaaaaaattgggcagggg
gcttcaggtacagttttcacagccaccgatgtggcattagggcaagaggttgctatcaaa
caaataaatttgcagaagcagcctaagaaagaactgatcattaacgaaattttggtgatg
aaagaattgaagaaccccaacattgtcaatttcttagacagttacctggtgggagacgag
ctgttcgtggtgatggagtacctggccggaggatcgctgaccgacgtggtaacggagacg
tgcatggatgaagcccagatcgccgccgtgtgccgagagtgtttacaggccctggaattt
ctccacgccaatcaagtgatccaccgagacatcaagagcgacaacgtgcttttgggcatg
gagggatcggttaaactcagtgagtag

DBGET integrated database retrieval system