KEGG   Ornithorhynchus anatinus (platypus): 100075898Help
Entry
100075898         CDS       T01045                                 

Definition
N-lysine methyltransferase SETD8-like
Orthology
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:oaa00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 326 aa AA seqDB search
MSRKYMPEGWKVNCIVWKENVFSGQSKIYSYMSSSKSPGARPPLQEENSVTHHEIKCPGK
ASNEMFKKEEEKRNLSSTLEGPVKLEEQKEKETKGASQESLHNQKLETAETLKNMVPPSG
SVVVVNAKQALKKPVKANQASRRKVQGKTQQNRKVTDYYPVRRSSRKSKAELQSEEKKKI
DELIESGKEEGMKIDFIDGKGRGVIATKQFARGEFVVEYHGDLIEITDAKKREALYAQDP
STGCYMYYFQYLSKTFCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDI
KAGEELLYDYGDRSRASIEAYPWLKH
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtccaggaaatacatgcctgaaggctggaaagtgaactgtatcgtttggaaggaaaat
gtgttttctggccagtcaaaaatctattcctatatgagttccagcaagtcgcctggagct
cgtccaccacttcaagaggaaaactcagtcacacatcatgaaatcaaatgcccggggaag
gcatcaaatgaaatgtttaaaaaagaagaagagaaaagaaatctcagtagtaccttagag
ggacctgtgaaattagaagaacagaaagaaaaagaaacgaaaggtgcttctcaagagtcg
ttacataatcaaaaactagaaactgcagagacgctgaaaaatatggtgccgccctccgga
tctgttgttgtagtcaatgccaagcaagctctgaaaaagccagtcaaagctaatcaggca
tcaaggagaaaagtgcaagggaaaacgcaacagaaccgcaaagttacagattattatcct
gttagaagaagctccaggaaaagtaaagcagagttgcagtctgaagaaaagaagaaaata
gatgaattgattgaaagtggaaaggaagaaggaatgaagattgatttcattgatggcaaa
ggcaggggggtaatcgccacaaaacaattcgctcgaggagaatttgtggtggaatatcac
ggggatctcatagagatcactgacgccaagaaacgagaggctctgtacgctcaagaccca
tccacaggctgctatatgtactatttccagtacctgagcaaaaccttttgcgtggatgcc
accagagagacaaatcgcctaggaagactaatcaatcacagcaaatgcggcaattgccaa
accaaacttcatgacatagacggtgtacctcatctcatactaattgcctcgagagacatt
aaagctggcgaagaactgctgtatgattacggtgaccggagcagagcttccattgaagct
tatccgtggctgaaacactaa

DBGET integrated database retrieval system