KEGG   Ornithorhynchus anatinus (platypus): 100076093Help
Entry
100076093         CDS       T01045                                 

Definition
lysozyme-like protein 1
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100076093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 153 aa AA seqDB search
MSSRVMKALGLLLLIDCLITFSQAKIYSRCKLARRLEHSGMDKFRGYSLENWLCVAYYES
GFDTEAQNTLEDGSTAYGIFQIDSRIWCKNDEEPSKNRCHISCSDLLNDDISDDIMCAKK
IVKETESMDYWDSWKIHCEDKDLSEWIEGCNDN
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgtctagcagggtgatgaaggccctcggcctcctgcttctgattgactgcctgatcaca
ttcagtcaagctaaaatctattcccgctgcaaactggcacggagattggagcacagtgga
atggacaaatttaggggctacagccttgaaaactggctctgtgtggcatattacgagagt
ggttttgacactgaagctcagaacactttggaagacggcagcactgcttacggcatcttc
cagatcgacagccggatatggtgcaaaaacgatgaggagccatccaagaaccgctgtcac
atttcctgctctgatttattaaatgatgatataagtgacgacataatgtgtgctaagaaa
attgtgaaggagactgagagcatggattactgggacagctggaagattcactgtgaagac
aaggacctctctgagtggatagaaggctgcaatgacaactga

DBGET integrated database retrieval system