KEGG   Ornithorhynchus anatinus (platypus): 100076094Help
Entry
100076094         CDS       T01045                                 

Definition
geranylgeranyl transferase type-1 subunit beta-like
Orthology
K11713  
geranylgeranyl transferase type-1 subunit beta [EC:2.5.1.59]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 389 aa AA seqDB search
MAAAAETAAAAAEEEEDRERSMADGCGERLDFLRDRHVRFFQRCLHVLPERYSSLFSCRL
TIAFFALSGLDMLDSLDVVNRDDIIEWIYSLQVLPTEDKSNLNRCGFRGSSYLGIPFSPS
KPPGTAHPYDSGHIAMTYTGLSCLVILGDDLSRVNKEACLAGLRALQLEDGSFCAVPEGS
ENDMRFVYCASCICYMLNNWSGMDMKKTIDYIRRSMSYDNGLAQGAGLESHGGSTFCGIA
SLCLMGKLEEVFTEKELNRIKRWCIMRQQNGYHGRPNKPVDTCYSFWVGATLKLLKIFQY
TNFERNRNYILSTQDRLVGGFAKWPDSHPDALHAYFGICGLSLMEENGICKVHPALNVST
RTSERLQDLHRIWKSKDSKQCPEDAHISS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggagacggcggcggctgccgctgaggaggaggaggacagggagagg
tccatggcggacgggtgtggggagcggctcgatttcctgcgggaccgccacgtccgtttc
ttccagcgttgtcttcacgtcctgccggagcgctactcatcgcttttttcttgtaggctg
acaattgcattttttgcactctccgggctggatatgttggattccttagatgtggtgaac
agagatgatattatagagtggatttattccctgcaggttcttcccacagaagacaaatca
aatttaaatcgttgtggattccgaggctcctcttacctgggaattcctttcagtccatca
aagcctcctggtacagctcacccttatgatagtgggcacatagcaatgacttatactggt
ctgtcgtgcctggttattcttggagatgacttgagccgagtaaataaagaagcttgcctg
gctggcctgagggcacttcagctggaagatggaagtttttgtgccgtaccggaaggtagc
gagaacgacatgagatttgtgtactgtgcttcctgcatttgctacatgctcaataactgg
tcaggcatggatatgaagaaaaccatagactacataagaagaagtatgtcctatgacaac
ggactggcgcagggagctggactagagtctcatggtggatccactttttgcggcattgcc
tcactctgtctgatgggcaagcttgaggaagtttttaccgaaaaagaactgaacagaata
aagaggtggtgtataatgaggcagcaaaacggctatcatggaagacccaacaagcctgtt
gacacctgctactccttttgggtgggagcaactctaaagcttctgaaaatattccaatat
acaaacttcgaaagaaacagaaattacatcttatcgactcaagatcgccttgtgggtgga
tttgccaaatggccagatagtcacccagatgctttgcatgcatactttgggatctgtggc
ttatccctaatggaagaaaatggcatttgcaaagttcatcccgccctgaatgtaagcaca
cgaacatctgaacgccttcaggacctccatcggatctggaagtccaaggactctaagcag
tgtccagaggatgcgcacatctcttcatga

DBGET integrated database retrieval system