KEGG   Ornithorhynchus anatinus (platypus): 100076094Help
Entry
100076094         CDS       T01045                                 

Gene name
PGGT1B
Definition
protein geranylgeranyltransferase type I, beta subunit
Orthology
K11713  
geranylgeranyl transferase type-1 subunit beta [EC:2.5.1.59]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.59  protein geranylgeranyltransferase type I
     100076094 (PGGT1B)
Prenyltransferases [BR:oaa01006]
 Protein prenylation
  Farnesyltransferase/geranylgeranyltransferase 1
   100076094 (PGGT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 368 aa AA seqDB search
MADGCGERLDFLRDRHVRFFQRCLHVLPERYSSLFSCRLTIAFFALSGLDMLDSLDVVNR
DDIIEWIYSLQVLPTEDKSNLNRCGFRGSSYLGIPFSPSKPPGTAHPYDSGHIAMTYTGL
SCLVILGDDLSRVNKEACLAGLRALQLEDGSFCAVPEGSENDMRFVYCASCICYMLNNWS
GMDMKKTIDYIRRSMSYDNGLAQGAGLESHGGSTFCGIASLCLMGKLEEVFTEKELNRIK
RWCIMRQQNGYHGRPNKPVDTCYSFWVGATLKLLKIFQYTNFERNRNYILSTQDRLVGGF
AKWPDSHPDALHAYFGICGLSLMEENGICKVHPALNVSTRTSERLQDLHRIWKSKDSKQC
PEDAHISS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgggtgtggggagcggctcgatttcctgcgggaccgccacgtccgtttcttc
cagcgttgtcttcacgtcctgccggagcgctactcatcgcttttttcttgtaggctgaca
attgcattttttgcactctccgggctggatatgttggattccttagatgtggtgaacaga
gatgatattatagagtggatttattccctgcaggttcttcccacagaagacaaatcaaat
ttaaatcgttgtggattccgaggctcctcttacctgggaattcctttcagtccatcaaag
cctcctggtacagctcacccttatgatagtgggcacatagcaatgacttatactggtctg
tcgtgcctggttattcttggagatgacttgagccgagtaaataaagaagcttgcctggct
ggcctgagggcacttcagctggaagatggaagtttttgtgccgtaccggaaggtagcgag
aacgacatgagatttgtgtactgtgcttcctgcatttgctacatgctcaataactggtca
ggcatggatatgaagaaaaccatagactacataagaagaagtatgtcctatgacaacgga
ctggcgcagggagctggactagagtctcatggtggatccactttttgcggcattgcctca
ctctgtctgatgggcaagcttgaggaagtttttaccgaaaaagaactgaacagaataaag
aggtggtgtataatgaggcagcaaaacggctatcatggaagacccaacaagcctgttgac
acctgctactccttttgggtgggagcaactctaaagcttctgaaaatattccaatataca
aacttcgaaagaaacagaaattacatcttatcgactcaagatcgccttgtgggtggattt
gccaaatggccagatagtcacccagatgctttgcatgcatactttgggatctgtggctta
tccctaatggaagaaaatggcatttgcaaagttcatcccgccctgaatgtaagcacacga
acatctgaacgccttcaggacctccatcggatctggaagtccaaggactctaagcagtgt
ccagaggatgcgcacatctcttcatga

DBGET integrated database retrieval system