KEGG   Ornithorhynchus anatinus (platypus): 100076098Help
Entry
100076098         CDS       T01045                                 

Gene name
PFN2
Definition
profilin 2
Orthology
K05759  
profilin
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100076098 (PFN2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100076098 (PFN2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100076098 (PFN2)
Exosome [BR:oaa04147]
 Exosomal proteins
  Proteins found in most exosomes
   100076098 (PFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 140 aa AA seqDB search
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAAPAGGIFPTTQPIEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH
GGGLNKKAYSMAKYLRDSGF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccggctggcagagctacgtggacaacctcatgtgcgatggctgctgccaggaggcc
gccatcgtcggctactgcgacgccaagtacgtgtgggccgccccggcgggggggattttc
ccgaccacgcagcccatagaaatagatatgatcgtaggaaaagaccgagaaggtttcttc
accaatggtttgactcttggggcaaagaagtgctcagtgatcagagatagtctatatgtt
gatggtgattgcacaatggacatcaggacaaagagtcaaggtggtgaaccaacatataat
gttgctgtaggcagagctggccgagtcttggtctttgtaatgggcaaagaaggggtccat
ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc
tag

DBGET integrated database retrieval system