KEGG   Ornithorhynchus anatinus (platypus): 100076108Help
Entry
100076108         CDS       T01045                                 

Definition
3-hydroxybutyrate dehydrogenase type 2-like
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:oaa00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:oaa00072]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 260 aa AA seqDB search
MEHNCLAPSPKHSVQFVLMEDGTARGQRSLAQFVSSLDLAFAKEGAKVIATDINEAQLRE
LEDCPGIQTRILDVTKKEQIEEFSKEVERLDVLFNVAGFVHHGTILECEEKDWDFSMNLN
IRSMYLMIKVFLPKMLAQKSGNIINMSSVASSIKGVVNRCVYSTSKAAVIGLTKSVAADF
IHQGIRCNCVCPGTVDTPSLRDRIQARPNPEQALSDFLARQKTGRMATAEEVALLCVYLA
SDESAYVTGNEMIIDGGWSL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggagcataactgcctggctcctagccctaaacattctgtacagtttgtcctgatggag
gatgggaccgcaaggggccaaaggtcattagcacaatttgtttcctccctggacttggct
tttgcgaaagaaggtgcgaaggtcatagccactgatatcaatgaggcccaactgcgagaa
ctggaggactgtccaggaattcaaactcggatactggatgtgaccaagaaggagcagatt
gaagagttctccaaggaagttgaaagacttgatgtcctcttcaatgttgctgggttcgtc
catcatggaaccatcctggagtgtgaagagaaagactgggatttcagcatgaatctcaac
attcgcagcatgtacctcatgattaaggtgttccttcccaaaatgcttgctcagaaatct
ggcaacattatcaacatgtcttctgtggcttccagcatcaaaggggtggtaaacagatgt
gtatacagcacctccaaagcggctgtgattggactgaccaaatctgtggcagcagacttc
atccatcaaggcatcagatgcaactgcgtttgtcccgggacggtggacaccccatctctg
cgggatagaatccaagccaggcccaatccggagcaggccctgagtgacttcctagccaga
cagaagactggaagaatggccactgccgaagaggtagcgcttctctgcgtgtatctggcc
tctgatgagtctgcctatgtgaccggcaatgaaatgatcattgatggaggctggagtctg
tga

DBGET integrated database retrieval system