KEGG   Ornithorhynchus anatinus (platypus): 100076365Help
Entry
100076365         CDS       T01045                                 

Definition
protein unc-13 homolog A-like
Orthology
K15293  
protein unc-13
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    100076365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 949 aa AA seqDB search
MWFFSLCLSPPLLSLPAVKKAKFDGAQEKFNTYVTLKVQNVKSTTIAVRGNLPCWEQDFM
FEINRLDLGLTVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQVIMTDNEI
CGTKDPTFHRILLDTRFELPLDIPEEEARYWAKKLEQLNAMRDQDEYSFQEEQDKPLPVP
GSQCCNWNYFGWGEQQNEDPDSAVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQYPMRH
QQSSRDSYTDSMQSYEMDFSDQRPIRCYGSVDSAPNGRSDAESASGSSRHTGRQYSLDLS
DSPTGSSRYASSGELSQGSSQLSDDFDPDNESLQGSEIEEERDGDSYHSCHSSVSYHKDS
PRWDREEDEEEEDLTREGYSENEEDYPKEEEEEEEEEEEEEEEELREIPGKEAYPPPTPA
PAELEEKPPVIPTAAPEGPKVLPESLVAEETPKSDRTTEPEPPKPEESYRVGEDAEGQDS
MSRAKANWLRVFNKVRLQLQELLTIITTLVYVPPPTGPMGGVHAGRCRLWGHPGPGGGLI
IIDSMPDIRKRKPIPLVSDLKNHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEG
LLWGIARQGMRCTECGVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMK
IRERNKPEIFELIQEIFAVSKTTHTQQMKAVKQSVLDGTSKWSAKISITVVCAQGLQAKD
KTGSSDPYVTVQVGKTKKRTKTIYGNLNPVWEENFHFECHNSSDRIKVRVWDEDDDIKSR
VKQRFKRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGFSFFLTPRSLQPIVLG
LLVLPRAFLPFPGYQRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVV
KDCVKACLNSTYEYIFNNCHELYSREYQTDPEMNSLNPAARLDAFDSQG
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcttctctctgtgtctctctccacctcttctttctcttcctgcagttaaaaaa
gctaagtttgacggagctcaagagaaattcaacacatacgtgaccctgaaggtgcaaaat
gtcaagagcacaactatcgcagtgcggggcaacctgccatgctgggagcaggatttcatg
tttgaaattaatcgcttggacctgggcctgacggtagaagtttggaacaaggggctcatc
tgggacactatggtgggcacagtgtggattccactcaggaccatccgccagtcgaatgag
gaaggacctggggagtggctcaccctcgattcccaggtcatcatgactgacaatgagatc
tgtggcaccaaagacccgaccttccaccgcattctcctggacacccgttttgagctgccc
ctggacatccctgaggaggaggctcgatactgggccaaaaagctggagcagctcaatgcc
atgcgggaccaagatgaatactcattccaagaggagcaggacaagccactacccgttcct
ggctctcagtgctgcaactggaattattttggctggggagagcagcagaatgaggatcct
gacagcgccgtggatgaccgagacagtgattatcgcagcgagactagcaacagtatccca
cccccctactacaccacctcccagcccaatgcctctgtccaccagtatcccatgaggcac
cagcagagctcccgggattcctacaccgattccatgcagagttatgagatggacttttcc
gatcagcggcccatcagatgctacggtagcgtagactctgccccaaatgggcgcagcgac
gccgagtccgcgtcgggctcgagccggcataccggccgccagtactccttagacctatcg
gatagcccgactggcagcagccgctatgcctcttctggggagctgagccagggcagctct
cagctgagcgacgactttgacccagacaatgagagcctgcagggctcagagattgaagaa
gagcgtgacggagactcctaccactcctgccacagctctgtcagctaccacaaggactca
ccccgttgggaccgggaggaagatgaggaagaggaggaccttacccgtgagggctacagc
gagaatgaggaagattaccccaaggaggaggaggaagaggaggaggaagaggaggaggaa
gaggaggaggagctccgggaaatccctgggaaagaggcctaccctcccccaacccctgct
ccagctgagctagaagagaagcccccagtcatccccactgcagctcctgaggggcccaag
gtgttgccagagtcattggtggcagaggagaccccaaaatctgatcggaccactgaacca
gagcctcctaagccagaggagagttacagggttggggaggatgcggagggccaggattcc
atgtcacgagccaaagccaactggttgagggtgttcaacaaagtgcggctgcagctccag
gagttactcaccatcatcaccaccctcgtgtatgtgcctccccccacgggccccatgggt
ggcgtgcatgcaggtaggtgtaggctctgggggcaccctgggccaggaggcggtctcatc
atcatagacagcatgcccgacattcgcaagagaaaacccatccccctagttagcgatctg
aaaaaccatgtttacaagaagacgcttcaagccttaatctaccctatctcctgcaccacg
cctcacaacttcgaggtgtggacggccaccacgcccacctactgctacgagtgcgagggg
ctgctgtggggcatcgcccgtcagggcatgcgctgcaccgagtgtggggtcaagtgccac
gagaagtgccaggacctgctcaacgccgactgtctgcagagagcggcagagaagagttcc
aaacatggggcagaggaccgaacccagaatatcatcatggtgctgaaggatcgaatgaaa
atccgtgaacgcaacaagcctgagatctttgagctgatccaggagatctttgctgtctcc
aagacgacccacacacaacagatgaaggccgtaaagcaaagcgtgctggacggcacttcc
aaatggtcagccaagatcagcatcaccgtggtctgtgcccaaggtctgcaggcaaaggat
aagacgggttccagcgatccctatgtcactgtccaggttggcaagacgaagaaacggact
aaaaccatctatgggaacctcaacccagtgtgggaggagaacttccacttcgaatgccac
aactcatcagatcgcatcaaggtgcgtgtgtgggatgaggacgatgacatcaagtcccgg
gtgaagcaacgtttcaagcgtgagtcggatgacttcctgggccagaccattatcgaggtg
cgcaccctgagcggcgagatggacgtctggtacaatctggataagcggactgacaagtca
gctgtgtccggattcagcttcttcttgacccccagaagccttcagcccattgtcctaggc
ctcctggtcctccccagggccttcctgccctttcctgggtatcagaggaataacttccct
gccagcagtcctgagaggctccaggacctgaagtcaacggtggatcttctcaccagcatt
actttcttccggatgaaggtacaggagctgcagagcccaccccgtgccagccaggtggtg
aaggactgcgtcaaggcctgtctcaactcgacctacgagtacatcttcaataactgccat
gagctatacagccgcgagtaccagaccgaccctgagatgaactcactgaaccccgctgcc
cgtttagatgcttttgattcccagggttga

DBGET integrated database retrieval system