KEGG   Ornithorhynchus anatinus (platypus): 100076655Help
Entry
100076655         CDS       T01045                                 

Gene name
USP20
Definition
ubiquitin specific peptidase 20
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 928 aa AA seqDB search
MGDSRDLCPHLDSIGEVTKEDLLLKSKGTCQSCGAGGPNLWACLQVGCPYVGCGESFADH
STLHAQAKKHNLTVNLTTFRVWCYACEKEVFLDQRLAAYPPAPPSKFSEQGSPLPSHPLK
AVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLV
RTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLM
DQLHEELKEPVVAETRDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQSRGVGVT
TTLAETELLIQDEAGRGISEKERMKDRKLSWGHRRTSSEQVDEDADVDTSVTAVDDRRPP
AEALPSPRSTSPCRTPEPDNDAYMRCSSRPCSPVHQDTHSKLSSSPPRSSPVRVGPSYIL
KKAQVLTAGKKKKELRYRSVISDIFDGSILSLVQCLTCDRVRPLIAAIQVLERRGLGAWT
GPLRGSGPRHRAPFARAGIRGGRDPTPRWGRDPVWKAVPVDCSDPASRRVPGDLRTRGTL
PRGFVVSCIPSWFWGPVVTLEDCLAAFFAADELKGESSRTGRGXPVCRPPRHPTILCIHL
KRFRHEVMYSFKINSHVSFPLEGLDLRPFLAKECVSQITTYDLLSVICHHGTAGSGHYIA
YCQNVINGQWYEFDDQYVTEVHETVVQNAEAYVLFYRKSSEEAMRERQQVVSLATMKEPS
LLQFYISREWLNKFNTFAEPGPITNHTFLCSHGGIPPNKYHYIDDLVVILPQNVWEYLYN
RFGGGPAVNHLYVCSVCQVEIEALAKRRRIEIDTFIKLNKAFQAEESPSVIYCISMQWFR
EWEAFVKGKDNEPPGPIDNSKIALLKGGGHIQVKQGADYGQISEETWIYLNALYGGGPEI
AIRQNVAQLQEPESLHGEQKIEAETRAA
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgggagactctagagacctctgccctcacctcgattccataggtgaggtcaccaaagag
gacttactcctcaaatccaaggggacttgccagtcatgtggagcaggaggaccgaatctc
tgggcctgtcttcaggttggctgtccttatgttgggtgtggggaatccttcgccgatcac
agcacccttcacgcacaggccaaaaagcacaacctgacagtgaacctgaccaccttccgg
gtgtggtgctatgcctgcgagaaggaagttttcctggaccagaggctggcggcgtatcca
ccagcccctccgtccaaattctcggagcagggttctccattaccttctcaccctctgaag
gcagtccccatcgcagtggctgatgaaggggagtccgaatctgaggatgatgatctaaaa
cctcgaggcctcactgggatgaaaaatctggggaactcctgctacatgaatgccgccctc
caggcactctccaactgcccgcccctgactcagttcttcctggaatgcggagggctggtt
cgcactgacaagaaacctgcactgtgtaaaagttaccaaaagctggtctctgaggtctgg
cacaagaaacgcccaagctacgtggttcccaccagtctgtcccatggaatcaagttggtc
aaccccatgttccgaggttatgcacagcaggacacacaggagttcctccgctgcctcatg
gaccagctccacgaagagctaaaggagccggtagtggccgagacgagagactctgactcc
agcgacacagacgagaagcgggagggagaccggagcccctccgaggacgaattcctctcc
tgcgactccagcagcgacagaggggagggggacgggcagagcaggggggtgggcgtgacc
accacgctggcggagaccgagctgctgatccaggatgaagcgggtagggggatctcggag
aaggagaggatgaaggacaggaaattatcctggggccaccggcgaacaagctccgagcag
gtcgatgaggacgccgatgtcgatacctccgtgaccgccgtcgatgaccgccgcccgccc
gccgaagcccttccctctccacgctccaccagtccgtgccggacaccagagccagacaat
gatgcttacatgcgctgttcctcccgcccctgcagcccggtccaccaggatacccactct
aaactgtcgagcagcccgccgcgctccagccctgtgagagtgggaccatcctacatccta
aagaaagcccaggtgctgactgccgggaaaaagaagaaggagctccgataccgcagcgtc
atctccgatatcttcgatggctccatcctcagcctggtgcagtgcctcacctgtgacaga
gtgcgtccccttatcgctgctattcaagtgttagagcgtcgtggcctcggggcctggacg
gggccccttaggggctctgggccccggcaccgggcccccttcgcccgggcggggattcga
gggggtcgggacccgactccccggtgggggcgggaccccgtgtggaaggcggtccccgtg
gactgctccgacccggcgtctcggcgggtgcccggggacctccgcacgcgcgggactctc
cctcgcgggtttgtggtgtcctgcatccccagctggttttggggccccgtggtcaccctg
gaagattgcctcgccgctttttttgccgcagatgagctgaagggtgagtcgagcagaact
ggccggggataaccggtttgccgtccacctcgccatccaacgatcctgtgcattcacctg
aagcgcttccggcacgaggtcatgtactccttcaaaatcaacagccacgtctccttcccc
ttggaagggctcgatctgcgacccttccttgccaaggagtgcgtctctcagatcactacc
tacgacctcttatccgtcatctgccaccacggcacagcgggcagtggccactacatcgcc
tactgccagaacgtgatcaacggccagtggtacgagtttgacgaccagtacgtcaccgag
gtccacgaaacggttgttcagaacgcagaagcctacgtcctgttctacaggaagagcagc
gaggaggccatgcgggagcggcagcaggtggtgtccctggccaccatgaaggagcccagt
ttgctgcagttctacatctcccgcgagtggctcaataaattcaacacctttgccgagccg
gggcccatcaccaaccacaccttcctctgctctcacgggggcatccctcctaataaatac
cattacatcgatgacctggtggtcatcctgccccagaacgtgtgggaatatctgtacaac
aggtttgggggcggcccagccgtgaaccacctgtacgtgtgctccgtctgccaggtggaa
atcgaagccctggcgaagcgccggcggatcgagatcgacaccttcatcaagctgaacaag
gcgtttcaggcagaggagtctcccagcgtcatctactgtatcagcatgcagtggtttcga
gagtgggaggccttcgtcaagggcaaggacaatgagcctccggggcccattgacaacagc
aagatcgccctgctcaagggaggaggtcacatccaggtcaagcaaggggctgactacggg
cagatttcggaggagacctggatctacttgaacgccctgtatggcgggggaccggaaatc
gccatccggcagaacgtggcccagctgcaggagcccgagagcctccacggggagcagaag
atcgaggccgagacccgggcggcctga

DBGET integrated database retrieval system