KEGG   Ornithorhynchus anatinus (platypus): 100076678Help
Entry
100076678         CDS       T01045                                 

Definition
sphingosine kinase 1-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:oaa00600]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:oaa04370]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:oaa04020]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:oaa04666]
Human Diseases; Infectious diseases; Tuberculosis [PATH:oaa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 326 aa AA seqDB search
MHPYLVDRAEESGLGGLAVQVRRLQADKPAGPPPWPRMGQLDSGPTAPIGLGPFPIYAPR
NEQVTNEELLTNCTHLLCRGLLAPMDLLSLQTASGRRLFSLLSLAWGFIADVDVESEKYR
RLGETRFTLGTLLRLAALRTYKGRLAYLPREGPTPPAPASSDPSPPVPGSDDPSPPASGP
KDSLLVPLEQPVPAHWTVVPEEDFVLVLALLQSHLGTEMRTAPMARGADGIIHLFYVRAG
ISRVSLLRLFLAMERGAHLDQGCTHLVHVPVSAFRLEPRAGRGMLTVDGEVMPTEAVQGQ
VHPGLCRIVGGIPEPSLGGGAATPAS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcacccttacctggtggaccgggcagaggagagcggcctgggtggcctggcggttcaa
gtcagacggctccaggccgacaagccggccggtccgcccccgtggccgaggatggggcag
ctggactcgggaccaacagcccccatcggactggggccttttcccatttacgctccccgg
aatgagcaggtgaccaacgaggagctgctgaccaactgcacgcacctgctgtgccggggc
ctgctggcgcccatggacctgctgtcgttgcagacggcctccggacgccgcctcttctcg
ctgctcagcctcgcgtggggcttcatcgccgacgtggacgtggagagcgagaagtaccgg
cggctgggcgagacccgcttcaccctgggcacgctgctgcgcctggccgctctgcgcacc
tacaagggccgcttggcctacctgcccagggagggcccgaccccgccggctcccgcctcc
agcgatccatccccgccagtccccggatccgatgacccgtccccgccggcctccggtccc
aaggactccctgctggtgcccctggagcagccagtgccagcgcactggaccgtggtgccc
gaggaggactttgtgctggtcctggcgctgctgcagtcgcacctgggcacagagatgcgc
acggcccccatggcgcgcggcgccgacgggatcatccacctcttctacgtgcgtgccggc
atctcgcgcgtgtccctgctgcgccttttcctggccatggagcggggcgcgcacctggac
caaggctgcacacacctggtgcacgtgcccgtgtccgccttccgcctggagccgcgggcc
ggccggggcatgctcacggtggacggggaggtgatgcccaccgaggcggtgcagggccag
gtgcacccgggcctctgccggatcgtgggcggcatccccgagccaagcttgggcggtggg
gcggcgaccccggcttcctga

DBGET integrated database retrieval system