KEGG   Ornithorhynchus anatinus (platypus): 100076678Help
Entry
100076678         CDS       T01045                                 

Gene name
SPHK1
Definition
sphingosine kinase 1
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100076678 (SPHK1)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100076678 (SPHK1)
   04020 Calcium signaling pathway
    100076678 (SPHK1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    100076678 (SPHK1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100076678 (SPHK1)
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     100076678 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 326 aa AA seqDB search
MHPYLVDRAEESGLGGLAVQVRRLQADKPAGPPPWPRMGQLDSGPTAPIGLGPFPIYAPR
NEQVTNEELLTNCTHLLCRGLLAPMDLLSLQTASGRRLFSLLSLAWGFIADVDVESEKYR
RLGETRFTLGTLLRLAALRTYKGRLAYLPREGPTPPAPASSDPSPPVPGSDDPSPPASGP
KDSLLVPLEQPVPAHWTVVPEEDFVLVLALLQSHLGTEMRTAPMARGADGIIHLFYVRAG
ISRVSLLRLFLAMERGAHLDQGCTHLVHVPVSAFRLEPRAGRGMLTVDGEVMPTEAVQGQ
VHPGLCRIVGGIPEPSLGGGAATPAS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcacccttacctggtggaccgggcagaggagagcggcctgggtggcctggcggttcaa
gtcagacggctccaggccgacaagccggccggtccgcccccgtggccgaggatggggcag
ctggactcgggaccaacagcccccatcggactggggccttttcccatttacgctccccgg
aatgagcaggtgaccaacgaggagctgctgaccaactgcacgcacctgctgtgccggggc
ctgctggcgcccatggacctgctgtcgttgcagacggcctccggacgccgcctcttctcg
ctgctcagcctcgcgtggggcttcatcgccgacgtggacgtggagagcgagaagtaccgg
cggctgggcgagacccgcttcaccctgggcacgctgctgcgcctggccgctctgcgcacc
tacaagggccgcttggcctacctgcccagggagggcccgaccccgccggctcccgcctcc
agcgatccatccccgccagtccccggatccgatgacccgtccccgccggcctccggtccc
aaggactccctgctggtgcccctggagcagccagtgccagcgcactggaccgtggtgccc
gaggaggactttgtgctggtcctggcgctgctgcagtcgcacctgggcacagagatgcgc
acggcccccatggcgcgcggcgccgacgggatcatccacctcttctacgtgcgtgccggc
atctcgcgcgtgtccctgctgcgccttttcctggccatggagcggggcgcgcacctggac
caaggctgcacacacctggtgcacgtgcccgtgtccgccttccgcctggagccgcgggcc
ggccggggcatgctcacggtggacggggaggtgatgcccaccgaggcggtgcagggccag
gtgcacccgggcctctgccggatcgtgggcggcatccccgagccaagcttgggcggtggg
gcggcgaccccggcttcctga

DBGET integrated database retrieval system