KEGG   Ornithorhynchus anatinus (platypus): 100076803Help
Entry
100076803         CDS       T01045                                 

Gene name
USP30
Definition
ubiquitin specific peptidase 30
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 500 aa AA seqDB search
MLSPRGLRRLLRTGAAVRYKVMKNWGVLGGIAAALVAGIYVLWGPITERKKRRKGLVPGL
LNLGNTCFMNSLLQGLSACPAFIKWLEDFTAQYSTDQKETSTDRYLSLTLLRLLKALSCQ
DVMNDDVLDASCLLEVLRLYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDIQ
SLEQQPEIIPQQVTCRTRGTPHPLPSHWNSQHPFHGRLTSNMVCKHCERQSPVRYDTFDS
LSLSIPAATWGRPVTLDHCLHHFISSESVRDVVCDNCTKIEAEGTLNGEMVENQRTTFVK
QLKLGKLPQCLCIHLQRLSWSNHGTPLKRHEHVQFNEFLIMDIYKYHLPGHKASQHNPKK
KDPALEMKTAAAIKRAAVDQPGGPKTLVMNGACSPALLPSPITLSLPVIPDYSSSSYLFR
LMAVVVHHGDMHSGHFVTYRRSPPPAKSPRSASSQWLWISDDTVRKASLQEVLSSSAYLL
FYERVLSKTEPRGQEYKSEE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgctgagccctcggggcctccggaggctgctgaggaccggagccgccgtcaggtataaa
gtgatgaagaactggggcgttcttggtggaattgctgctgctctcgtggcaggcatatat
gtcctctggggtcccatcactgagaggaagaagcgcagaaaagggctggtccccggtctc
ctcaacttagggaacacctgcttcatgaactctctgctgcaaggcctgtctgcttgtccg
gctttcatcaagtggttggaagacttcacggcgcaatattcaaccgatcagaaggagacc
tccactgaccgctatctgtccttgactctgctacgcctcctgaaagctctgtcctgccaa
gacgtcatgaatgacgatgtcttagatgcaagttgcctattagaagtgttacggctctac
aggtggcagatctcgtcattcgaggaacaggacgctcacgaattattccacgtcattacg
tcgtccttagaagatgagagagaccgccagccccgggtgacgcatttgtttgacattcag
tctttggagcagcagccagaaataatcccccaacaagtaacctgcagaacaagagggaca
cctcatcccttgccaagccactggaattcgcaacacccctttcacggaagactgaccagc
aacatggtttgcaaacactgtgaacgccagagtcccgtgagatacgatacctttgacagc
ctttcgttaagtattccagccgccacctggggtcgtcccgtgactttggaccactgccta
catcatttcatctcctctgaatccgttagggatgttgtgtgtgacaactgcaccaagatt
gaagcggaagggactctcaatggagaaatggttgaaaaccagaggaccacattcgtaaag
cagttaaagttgggaaagctcccccagtgcttgtgcatccaccttcagcgtctcagctgg
tccaatcacggcacacctctgaaacgccacgaacacgtacagtttaacgagttcttgatc
atggatatttacaagtaccatctccctgggcacaaggcaagtcaacacaaccccaagaag
aaagaccccgcgttggaaatgaagactgcagccgccatcaaaagagcagcagtggatcag
ccaggtggccccaaaaccttggttatgaacggagcctgctcacctgctttattaccttct
ccgataaccttgtctctcccggtcattcctgactacagctcctcctcctacctgttccgc
ctcatggcggtggtggttcaccacggggacatgcattctggacactttgtgacataccga
cgctccccacctcccgccaagagcccccgctccgccagcagccagtggctgtggatttcc
gacgacacggtccgcaaggccagcttgcaggaggtcctctcctccagcgcttacctgctc
ttttacgagcgcgtgctttccaaaaccgagccccggggtcaagagtacaagtcggaagaa
tga

DBGET integrated database retrieval system