KEGG   Ornithorhynchus anatinus (platypus): 100076923Help
Entry
100076923         CDS       T01045                                 

Gene name
ACACB
Definition
acetyl-CoA carboxylase beta
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
AMPK signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100076923 (ACACB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100076923 (ACACB)
   00640 Propanoate metabolism
    100076923 (ACACB)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100076923 (ACACB)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100076923 (ACACB)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100076923 (ACACB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100076923 (ACACB)
Enzymes [BR:oaa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100076923 (ACACB)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100076923 (ACACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2447 aa AA seqDB search
MLLILTFLLLTFAWFVSSAMADLKPPTASEPEVPPREPSPDPVDKGDPETAQAQQNSEVN
EPPSRPNQAMPDPSRASQNPGHLATRPPHWRPSNDPPVLDATSATADHRANGLEGSPTPD
LLSPSGSQAKRVRPLSKEDQKQARIRKQLMTKFILGSFDDNSSDDEAVAGAFKASSRRSS
RSSFGSSSFETSSLLGLTRSESTPIMRPSMSGLHLVKRGREQKKLEQQRDFTVASPAEFV
TRFGGNRVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYI
KMADHYVPVPGGPNNNNYANVELIVDISKRIPVQAVWAGWGHASENPKLPELLHKNGIAF
LGPPSEAMWALGDKVASTIVAQTLQIPTLPWSGSGLSVDWTASDLQQMKRISVPQEVYVR
GCVRDVDEGLEAAEKIGFPVMIKASEGGGGKGIRKAESAEDFPILFRQVQSEIPGSPVFV
MKLAQHARHLEVQILADQYGSAVSLFGRDCSIQRRHQKIIEEAPATVAPPAVFEYMEQCA
VRLAKTVGYVSAGTVEYLYSDDGSFHFLELNPRLQVEHPCTEMIADVNLPAAQLQIAMGV
PLNRLKDIRILYGELPWGILPISFENPTNPPVPRGHVIAARITSENPDEGFKPSSGTVQE
LNFRSSKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFR
TTVEYLINLLETESFQGNDIDTGWLDYLIAERVQAEKPDIMLGVVCGALNVADALFRTCM
TDFLHSLERGQVLPAASLLNIVDVELIYDGVKYTLKVARQSLTMFVLIMNDGHIEIDAHR
LNDGGLLLSYDGNSYTTYMKEEIDSYRITIGNKTCVFEKENDPTVLRSPSAGKLLQYTVE
DGGHVVAGNSFAEIEVMKMIMTLNVQESGRVYYVKRPGAVLEAGCSVARLELDDPSKVHP
AEPFTGNLPAQQTLPIMGEKLHQVFHNVLENLTNVMNGYCLPEPIFSAKIKEWVSKLLVT
LRDPSLPLLELQEIMTSVSGRIPPSVEKSVRKVMAQYASNITSVLCQFPSQQIANVLDCH
AATLQRKADREVFFMNTQSIVQLVQRYRSGTRGYMTAVVLELLRKYLQVEHNFQQAHYDK
CVINLREQFKPDMSQVLDCIFSHAQVAKKNLLVTMLIDELCGPDPTLTDELLAILNELTQ
LSKTEHSKVALRARQVLIASHLPSYELRHNQVESIFLSAIDLYGHQFCPDNLKKLILSET
TIFDVLPMFFYHVNPVVCMASLEVYVRRGYIAYELNSLQHRKLPDGTCVVEFQFMLPSSH
PNRMHIPISVTNPDLVRHSTELFMDSGFSPLCQRMGAMVAFTKFEDFTRNFDDVISCFAN
LPKDCPLFHEARSTLYCEEDSKNVREEPIHILNVAIKCADHLEDEALVPVFRTFVQSKKN
ILVEYGLRRITFLIAQQREFPKFFTFRARDEFAEDRIYRHLEPALAFQLELNRMRNFDLT
AVPCANHKMHLYLGAARVEEGAEVTDYRFFIRAIIRHSDLITKEASFEYLQNEGERLLLE
AMDELEVAFSNTTVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAE
VKINIRLTTTGTAIPIRLFLTNESGYYLDISLYKEVTDAGTGNIMFNSFGDKEGAQHGML
INTPYMTKDLLQAKRFQAQSLGTTYVYDFPEMFRQALFKLWGSSDKYPKDVLTCTELVLD
SQGQLVQMNRLPGGNEVGMVAFKMKMKTREYPEGREVIVISNDITFKIGSFGQGEDLLFL
RASELARAQGIPRIYLSANSGARIGLAEEIRDMFRVAWVDPEDPYKGFKYLYLTPQDYTR
ISSLNSVHCEHVEEGGESRYVITDIIGKDDGLGVENLRGSGTIAGESSLAYEEIVTVSMV
TCRALGIGAYLVRLGQRVIQVENSHIILTGASALNKVLGREVYTSNNQLGGVQIMHFNGI
SHITVPDDFEGVYTILEWLSYMPKDNRSPVPIITPMDPIDREIEFVPSKAPYDPRWMLAG
RPHPTVKGTWQSGFFDQSSFKEIMEPWAQTVVTGRARLGGIPVGVIAVETRSVELVIPAD
PANLDSEAKIIQQAGQVWFPDSAFKTAQAIKDFDRERLPLLIFANWRGFSGGMKDMYDQV
MKFGAYIVDGLRQYKQPVLIYIPPYAELRGGSWVVIDPTINPFCMELYADKESRGGVLEP
EGTVEIKFRKKDLIKAMRRIDTVYGKLVEQLGSPELSEKDRRDLERKVKGREELLLPIYH
QVAVQFADLHDTPGRMQEKGVITDILEWKNSRTFLYWRLRRLLLEGVVKNEILLANSELS
HVHIQSMLRRWFLETEGTVKGYLWDNNQVVAAWLEKHLQEEDGSRSAIRENIKYLKRDFA
LKNIRGLVQEHPEVVMDCIVHMTQHISPAERAQVAHLLATLENPSST
NT seq 7344 nt NT seq  +upstreamnt  +downstreamnt
atgctcttgatcttgactttcctactcctgacttttgcgtggtttgtgtcgagcgccatg
gccgacttgaagcctcctactgcaagtgagcccgaagtcccaccccgagagccttctccg
gaccccgtggacaaaggggacccggaaacggctcaagctcagcaaaactcggaggtgaat
gagcccccttcgaggcccaaccaagccatgccagaccccagccgggcctcccaaaacccc
gggcatctggcgactcgtccgccgcactggagaccctccaacgaccctccggtcctggat
gcgacgtcagcgacggccgaccaccgagccaacggtttggaagggtctcccactccggac
ctcttgtcgccctccggctcccaggccaagagggtcaggcccctgtccaaggaagaccag
aagcaggcccggatcagaaagcagctgatgaccaagttcatcctgggctcttttgacgac
aactcttccgacgacgaggccgtggccggggcgttcaaggcctcttccaggaggagcagt
cgctcgagctttggctcctcatcttttgagacttcctctctactgggcctgacgaggtct
gaatccaccccgattatgaggcctagcatgtcaggactgcatttggtaaagaggggacga
gagcagaagaagctggaacagcaaagagacttcaccgtcgcctctccagctgagtttgtg
actcgttttggggggaatcgggtcattgagaaggtcctcatcgccaacaatggcatcgcc
gcagtcaagtgcatgcgctccatccgccgatgggcctatgagatgttccgcaacgagcgg
gccatccgcttcgtcgtcatggtaaccccagaggacctaaaagccaacgcagaatacatc
aaaatggccgatcattacgtgcccgtccctggcgggccaaacaacaacaattatgccaac
gtggagctgattgttgatatctctaagaggatcccagtacaggcggtgtgggccggctgg
ggacacgcctcggagaaccccaaacttcctgagctgctccacaaaaatggaattgccttt
ttaggtcctccgagtgaagccatgtgggccctgggggataaagtggcttccaccatagtg
gcccagacccttcagattccaaccttgccgtggagtggaagtggtttgtcggtggactgg
acggccagtgaccttcagcagatgaagaggatcagcgtaccccaagaggtgtatgtccgg
ggctgtgtgagagacgttgatgagggcttggaggcagcggaaaaaattgggttccccgtg
atgatcaaagcttccgaaggaggcgggggcaaaggcatcaggaaggccgagagtgctgag
gattttcccattctcttccgacaagtgcagagcgagatcccgggctcgcccgtgttcgtc
atgaagttggctcagcacgcccgccacttggaggttcagattctggcagaccagtatggc
agcgccgtgtccctcttcggccgagactgctccatccagcggcgacatcagaagatcatt
gaggaggccccggccaccgtcgccccaccggctgtattcgagtatatggagcagtgtgcc
gtgcgcctggccaaaaccgtgggctacgtgagcgcgggaacagtagagtacctatacagc
gacgacggcagcttccacttcctggagctcaacccccgcctgcaagtggaacacccctgc
actgaaatgatcgcggacgttaacttaccagctgcccaactccagattgcgatgggggtg
cctctcaacaggctgaaggacatccgcatattgtatggagagttaccctgggggatctta
cccatctcctttgaaaatcccacaaatcctccagtgcctcgaggccatgttatcgctgct
agaatcaccagtgaaaatcccgatgagggatttaagccgagctccgggaccgtccaggag
ttgaattttcgcagcagtaagaacgtgtggggttacttcagcgtggcagctgccggcggc
ttgcacgagtttgccgattcccaatttgggcactgcttctcctggggagagaaccgggaa
gaggccatttcgaacatggtggtggccctgaaagaactgtccatccgtggggatttccgc
accaccgtagaatatcttattaacctactagaaaccgaaagcttccaaggcaacgacatt
gacactggatggttggattaccttatcgcagagagggtccaggccgagaagcccgacatc
atgcttggggtcgtttgcggagccttgaatgtagccgacgccttgttcagaacctgtatg
accgacttcttgcactcccttgaaaggggccaggttctcccagctgcatctcttttaaac
attgtagatgtagagcttatttatgatggcgtcaaatatactctcaaggtggcccgtcag
tctctcactatgtttgtcctcataatgaacgacggtcacatcgagatagatgctcacagg
ctgaatgacgggggattgcttctgtcatatgatgggaacagttacaccacgtacatgaaa
gaagaaatcgatagttatcgaatcacgattggcaacaaaacgtgcgtgtttgagaaggag
aatgacccgacggtcctgaggtcgccttctgccgggaaactgctgcagtatacggtggag
gatggaggccatgtggtggctggaaacagctttgcggagatagaggtgatgaaaatgatc
atgaccttgaacgtccaagaaagcggccgggtctactacgtaaagcgccctggagcggtg
ctggaggcagggtgctcagtggccagactggaattggatgacccatccaaagtccacccg
gctgaaccattcacaggaaacctccctgcccagcaaaccttgcctattatgggggagaaa
ttgcaccaggttttccacaatgtgctagagaatctgaccaacgtcatgaatggctactgc
ttgccagaacctattttcagtgcaaagatcaaagaatgggtgtccaagctgctagtgact
ctgcgagacccttccttgcccctcctggagttgcaggagattatgaccagcgtgtccggc
cggatcccgccctccgtggagaagtcggtccgcaaagtgatggcccagtacgcgagtaac
atcacctctgtactctgccagttccccagccaacagatagcaaacgtgttggactgccat
gccgccaccttgcagcggaaggcggatagagaagttttcttcatgaacacgcaaagcatt
gtgcagctagtccagaggtaccgcagtggaacacgtggctatatgacagcagtggtgttg
gagttattaagaaaatacctacaagttgaacataattttcaacaagcacactatgacaaa
tgtgtcatcaacctcagggaacagttcaaaccggatatgtctcaagtgctggactgtatt
ttctcacatgcccaagtggccaagaagaacctgctggtgaccatgttaattgatgagctg
tgtggccctgatcccacactgaccgacgagctgctggccattctcaacgagctcacccaa
ctcagcaagaccgaacactccaaggtggccctcagagctaggcaggttttgatagcttct
caccttccttcctacgaattaaggcacaaccaagtagagtctatcttcctttccgccatc
gacttatacggacaccagttttgccccgacaacctgaagaaactgatcctgtctgaaacg
accatctttgatgttctgcccatgtttttctaccacgttaaccctgtggtctgcatggct
tccttggaggtgtatgtccggagaggatacatcgcctacgagttaaacagcctgcaacac
cggaaactcccggacggcacctgcgtagtagaattccagttcatgttgccttcgtctcat
ccaaaccggatgcacatccccatcagcgtgaccaaccccgacctggtccggcatagcacc
gagctcttcatggacagcggtttctccccgctgtgtcagaggatgggagccatggtcgcc
ttcacgaaattcgaggattttaccaggaattttgacgatgtcatttcctgcttcgccaac
ctgcccaaggactgtcccctgttccatgaggcccgatccaccctgtactgcgaggaggac
agcaaaaacgtgagggaagaacccatacatattttgaacgtggccatcaagtgcgcggat
cacctcgaggatgaagctcttgtgccagtcttccggacttttgtgcagtcgaagaaaaac
atcctggtggaatacggtctccggagaatcacatttttaatcgcccagcagagagaattt
cccaagttttttactttcagagcgagagatgagtttgccgaagacagaatctaccgccat
ctggagcccgctttggccttccagttggagctgaatcgaatgcggaactttgatctgacc
gccgtgccttgtgccaatcataagatgcatctttacctaggagccgccagggtggaagaa
ggtgctgaagtgaccgactataggttcttcatccgggccatcatcagacactctgacttg
attacgaaggaggcctccttcgagtatcttcagaatgaaggggaacggctgctcttggaa
gcgatggacgagctggaggtggccttcagtaataccaccgtccgcaccgactgcaaccac
atcttcctcaacttcgtccccacggtcatcatggacccttccaagatcgaagagtcggtt
cgctctatggtgatgcgctacgggagccgcctgtggaaacttcgtgtcctgcaagccgaa
gtcaagatcaatatccgcctgaccacgactggcaccgcaatccccattcgcctcttcctg
accaatgaatctggttactacctggacatcagcctctataaagaagtgacggatgccggg
actggaaacatcatgttcaactccttcggagataaagaaggtgctcagcatgggatgtta
atcaacactccgtacatgaccaaggacctgttacaagcgaagagattccaggcccaatcc
ctgggaactacttatgtttacgactttcccgaaatgttccggcaggctctgtttaaattg
tggggctcctcagacaagtaccccaaagatgtcctgacttgcacggagctggtgctggat
tctcagggccaactggtccagatgaacaggctacccggaggcaatgaggtgggcatggtg
gccttcaaaatgaagatgaagacccgagagtatcccgagggccgcgaagtgatcgtcatc
agcaatgacatcacgttcaagatcggctccttcggacagggggaagacctcctgttccta
cgggcttcggaactggcccgcgcccagggcatccccaggatctacctctcggccaacagc
ggggcccgtatcggcctggccgaggagatccgggacatgttccgggtggcctgggtggac
ccagaagacccttacaaagggttcaagtacctgtacctgactccccaagactacacccga
atcagctccttgaactctgtccactgtgagcatgtggaggaaggaggagaatccaggtac
gtgatcacggacatcatcgggaaggacgatgggctcggagtggagaacctgaggggctcg
ggcaccattgctggggagtcgtccctggcttatgaggaaatcgtcaccgtgagcatggtt
acttgccgggctctcggcattggggcctacctggtgcgactgggccagcgggtgatacag
gtggagaactcccatatcatcttgactggggccagtgctttgaacaaggtcctgggtcgt
gaagtctacacatccaataaccagttgggtggtgtacagataatgcatttcaatggcatt
tcccacatcacggttccagatgactttgagggagtctataccatcttggagtggctctct
tatatgcccaaggataatcggagcccggtgcctatcattacacccatggaccccattgac
cgagaaattgagtttgtcccttctaaagccccctatgatccccggtggatgttggctgga
agacctcatccaactgtgaaggggacgtggcagagtggcttctttgaccagagcagcttc
aaggagatcatggagccctgggcacagaccgtcgttactggcagggcaaggttgggtgga
atccccgttggggtaatcgcggtggagacgcggtccgttgagctggtcatcccagctgat
cccgctaatctggactctgaagcaaagatcatccagcaggccggccaggtttggttccca
gactcagcctttaaaactgcccaggccattaaagacttcgaccgggagaggctgcccctt
ctgatctttgccaactggagaggattctctggaggcatgaaagatatgtacgatcaggtg
atgaaatttggcgcctacatagtcgacggcctaaggcagtataaacagcccgtccttatt
tacattccaccgtacgctgagctcaggggaggatcgtgggtggtcattgatccgacaatc
aacccattctgcatggagctgtatgccgacaaagagagcagagggggcgtcttggagccc
gaaggaaccgtggagatcaagttccggaagaaagatttgataaaagccatgagaagaata
gatactgtgtatgggaagctcgtcgaacagctgggttcgccggaattgtcggagaaggat
cgcagagatctggagaggaaggtgaaagggcgggaggagctcctcttgcctatatatcac
caggtggcagtgcagtttgccgacctgcacgacaccccgggaagaatgcaagaaaaggga
gtcattacggatattttagagtggaaaaactcccgtacgttcttatactggcggctgcgt
cgactgctcctggagggtgtcgtgaaaaacgagatcctgctcgccaacagcgagctgagc
cacgtccacatccagtctatgctgcgtcgctggttcctggagacggagggcaccgtgaag
gggtacctctgggacaacaaccaagtggtggcagcgtggctggagaaacacctgcaggaa
gaggacggctcccgctccgccatccgggagaacatcaaatacctcaagcgggacttcgcc
ctcaagaacatccgaggcctggttcaggagcatcctgaggtggttatggactgcatcgtt
cacatgactcaacacatcagccccgcagaaagggcccaggtagcccacctgctcgccacc
ttggaaaacccctcctccacctga

DBGET integrated database retrieval system