KEGG   Ornithorhynchus anatinus (platypus): 100077098Help
Entry
100077098         CDS       T01045                                 

Gene name
MAPK4
Definition
mitogen-activated protein kinase 4
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100077098 (MAPK4)
Protein kinases [BR:oaa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100077098 (MAPK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 579 aa AA seqDB search
MAEKGDCIASMYGYDLGCRFVDFQPLGFGVNGLVLSATDSQSCRKVAVKKIAVSDARSMK
HALREVKIIRRLDHDNIVKVYEVLGPKGVDLQGQLFKFNVVYVVQEYMETDLARLLEQGT
LTEDHAKLFMYQLLRGLKYIHSANVLHRDLKPANIFISTEDLVLKIGDFGLARIVDQHYS
HKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAGGHELEQMQL
ILETIPVIREEDKDELLKVMPSFINCTWEVKKPLRKLLPQVNSEAIDFLEKILTFNPMDR
LTAELGLQHPYMSPYACPEDEPISQHPFRIEDEIDDILLMAANQSQLSNWDRYHISLSSD
LEWRHDRYQATSEVQRDPRAGSESIAEEAQVDPRKYSQSSSERFLDQSHSSMDRAFEADY
GRSCDYKVGSPSYLDKLLWRDNKPHHYSEPKLILDLSHWKKASIAPAAELALEEEPSNLF
LEIAQWVKSTQAGLECPGPLPEIQEQSLPSSPHHHRAPKEANHSTDPQFDLDVFISRALK
LCSKPEDLPDSKLGEINGACIGERPSDIVQTEAYQKERW
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaagggggactgtatcgccagcatgtacggctacgacctgggctgtcgcttt
gttgacttccagcccctgggctttggggtcaacgggctggtcctctcggccacggacagc
cagagctgccggaaggtggccgtgaagaagatcgccgtgagcgacgcccggagcatgaag
cacgcgctgcgggaggtcaagatcattcgccggctggaccacgacaacatcgtcaaggtg
tacgaggtgttggggcccaagggggtggacctgcaggggcagctgttcaagttcaacgtg
gtgtacgtggtccaggagtacatggagacggatctggcccggctcctggagcagggcact
ctgaccgaggaccacgccaagctcttcatgtaccagcttctccgcgggctgaagtacatt
cactcggccaacgtcctgcacagggacctgaagccggccaacattttcatcagcaccgag
gacctcgtcctgaagattggggacttcggcttggcccggatcgtcgatcagcattactcc
cacaagggttatctgtcagaagggttggtaacgaaatggtatcgatctcctcgcctgctc
ctctcacccaacaactacaccaaagccatcgatatgtgggcggcagggtgcatcctggca
gaaatgctcactgggagaatgctgtttgctggaggccacgagctggaacagatgcaactc
atcctggagacaatccctgtgatccgggaagaggacaaagatgaactcctcaaagtgatg
ccttccttcatcaactgcacctgggaagtgaagaaaccactgcggaaactgcttcctcaa
gtgaacagcgaagctattgatttcctagagaagatcctaacctttaaccccatggaccgc
ttaacagctgagctggggctgcagcacccttatatgagcccttacgcctgccccgaggat
gagcccatctcccagcacccattccgcatcgaggacgagattgacgatatcctgctgatg
gcggccaaccagagccagctgtccaactgggacagatatcacatcagtctgtcttcggac
ctagaatggagacacgatcgataccaggccaccagtgaggttcagcgggatccccgcgcg
ggttccgaatccatcgcggaagaggcccaggtggatccgcggaagtattcccagagcagt
tcggaacggttcctggaccagtcccactcctccatggaccgagcattcgaagcggactac
gggcggtcctgcgactacaaggtcggctctccctcctacctggacaagctgctgtggagg
gacaacaagccccatcactactctgagcccaagctcatcttagacttgtcccactggaaa
aaagcatccatcgcccctgccgccgagctggccctggaagaggagccgtccaatctcttc
ctggagatcgcccagtgggtgaaaagcacccaggcggggctggagtgccccggacccctc
cccgagatccaggaacagagcctgccctcctccccccaccaccaccgggcccccaaggag
gcgaaccacagcactgaccctcagttcgacttggacgtcttcatctcccgggcccttaaa
ctctgctccaaacccgaggacctgcccgacagcaagctgggagagatcaacggggcctgc
atcggagagcgccccagtgatatcgtgcagaccgaagcctatcagaaggagaggtggtga

DBGET integrated database retrieval system