KEGG   Ornithorhynchus anatinus (platypus): 100077134Help
Entry
100077134         CDS       T01045                                 

Definition
beta-galactoside alpha-2,6-sialyltransferase 2-like
Orthology
K00779  
beta-galactoside alpha2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:oaa00510]
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:oaa00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 522 aa AA seqDB search
MKPNLKQWKQLMLFGIFAWGLLFLAIFIYFADSNPTAPVPSTFYVEPRRLLPVQGKQRAI
MGAVPEPAFPEGEARSETRCESLLCADLPDSLWPEPEDAGDIEEEFFSPQVQRGRESPRA
HDPALGDSSFTADRPGPRGLARRGASLVSAGEQGLFRSGRVPRKRIKKRRSKRGRSRPPE
EADEWERLYSSAMSRSFLYRLWKGNVSSRMLNPRLQKAMKDYLSINKHGVRFQGPRNGRL
TGEQLLCQLRDRVHVRTLDGKEAPFSALGWDKHVPRTPLAKLYPRGFGSCAVVMSAGAIL
NSSLGAEIDAHDAVLRFNSAPTRGYEKDVGNKTSLRIINSQILTNPSHHFIDNSLYKDVI
LIAWDPAPYSANLNVWYKKPDYNLFTPYVQHRRRYPSQPFYILHPKFIWQLWDIIQENTR
EKIQPNPPSSGFIGILIMMSMCREVHVYEYIPSVRQTDLCHYHELYYDAACTLGAYHPLL
YEKLLVQRMNRGERDDLYRKGKVILPGFRALRCPAPDHLPHS
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaaacctgaagcagtggaaacagctgatgcttttcgggatatttgcctgggga
ctcctgtttttggccatcttcatctactttgccgacagcaaccccaccgcgccggtcccc
agcaccttctacgtggagccccgcaggctcctacccgtgcaggggaagcagcgggccatc
atgggtgccgtgccggagccggccttccccgagggtgaggcgcgaagcgagacgcgatgt
gagtcgctcctttgcgccgacctccccgactccctctggcccgagccagaagacgccggg
gatatcgaagaagagtttttctcccctcaggttcagagagggcgggagtccccaagggcg
cacgatcccgccctcggtgactcctcgttcaccgccgaccggcctgggcctcgtggtctg
gccaggcgtggggcgagcctggtttctgccggggagcagggccttttccggtccggtcga
gttccccggaagagaataaagaagagacgttcgaagcgcgggaggagccggccgccggag
gaggcagacgagtgggaaaggctgtatagcagcgccatgtcacgttccttcctttaccgg
ctctggaagggtaatgtgtcgtcgaggatgctgaatccccgcctgcagaaagccatgaag
gactacctgagcatcaataagcacggcgtgcgcttccagggcccgaggaacggcaggctg
accggcgaacagctgctgtgccagctcagggaccgcgtgcatgtgaggacgttggatggg
aaggaggcccccttctcggccctcgggtgggacaagcacgtcccgcggactcccctggcc
aagctctatccccgcggcttcgggagctgtgccgtggtcatgtctgcgggggccatcctc
aactcgtccttaggcgcggagatagatgctcatgatgcagttttacgatttaactctgct
cctacacgcggttatgaaaaagatgttgggaataaaacatccctgcgcatcattaactct
cagatcctgaccaatccaagtcaccatttcattgacaattccttatataaagatgtcatt
ttaatcgcctgggaccctgctccttattctgccaatcttaatgtgtggtacaagaagcca
gactacaacctgttcactccttacgtgcaacataggaggaggtacccaagtcagccattc
tacatccttcaccccaaatttatctggcagctgtgggacatcatccaggagaatacgaga
gagaagatccagcccaacccaccatcctccggcttcatcggaatactcatcatgatgtcc
atgtgcagagaggtgcacgtgtacgagtacatcccgtcggtccgccagaccgatctctgt
cactaccacgaactctactatgacgcagcctgcaccttgggcgcctaccaccccctgcta
tacgagaagctgctcgtccagaggatgaacaggggtgagagggacgacctgtaccgcaaa
gggaaagtgattcttcccggattccgggccttgcgctgtcctgcccccgaccatctcccc
cactcgtag

DBGET integrated database retrieval system