KEGG   Ornithorhynchus anatinus (platypus): 100077208Help
Entry
100077208         CDS       T01045                                 

Gene name
KMT2E, MLL5
Definition
lysine (K)-specific methyltransferase 2E
Orthology
K09189  
histone-lysine N-methyltransferase MLL5 [EC:2.1.1.43]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100077208 (KMT2E)
Enzymes [BR:oaa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100077208 (KMT2E)
Transcription factors [BR:oaa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    100077208 (KMT2E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1735 aa AA seqDB search
MSIVIPLGVDTTETSYLEMAAGSEPESVEASPVVVEKSNSYPHQLYTSSSHHSHSYIGLP
YADHNYGARPPPTPPASPPPSVLISKNEVGIFTTPNFDETSSATTISTSEDGSYGTDVTR
CICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDIYLCERCQPRNLDKDRAVLLQRRK
RENMSDGDTSATESGDEVPVELYTAFQHTPTTITLTAARVTKVNDKKRKKSVEKEQNISK
CKKAFREGSRKSSRVKGSAPEIDPSDGSNFGWETKIKAWMDRYEEANNNQYSEGVQREAQ
RIALRLGNGNDRKEMNTRSELNASNMIFKPPVESYVQKNKKILRAAKDLPPDALIIEYRG
KFMLREQFEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHV
IEDGTIHLYIYSIQSILKGIEITIAFDFDYGNCKYKVDCACLKENPECPVLKRGSEPTEN
INSGYETRRKKGKKEKDISKEKETQNQNITLDCDGAANKMKSPDNKQRKLSPLRLSISNN
QEPDYIEEIEEKTPISNEVEMESEEQIAERKRKLTREERKMEAILQAFARLEKREKRREQ
ALERISTAKTEVKPECKDAQIINEAELVQEPAKEETASKPTPAKVNRAKQRKSFSRSRTH
IGQQRRRHRTVSMCSDIQPSSPDVEVTSQPNETENSALAAEPDTEPAVAEIIPETEAPAL
NKCSTKYPKTKKHLVNEWLSEKSEKPGKPTDSLSERPLRITTDPEVLATQLNSLPGLSYS
PHVYSTPKHYIRFTSPFLSEKKRRKEPSENVSGSCKKRWLKQALEEENTAIIDRFNSPCQ
ERSRSPTVNGENKSPLLLHDGSSVQDLTTPLKKRRLYQILDAAYSETSTPTPSPYATPTH
ADITATDPSLFATPPRVKSEDETCRNGYKPIYSPVTPVTPCLHGNAMHFENISSPESSPE
IKRRAYSQEGYDRTSTMLALGSFRNSNLTEISLQEIKTVGYSSPRTRPELSRQCPGEKES
VSDLQMGLDVIEQSALHKNMETPSHERTDSNSQLETAHCGRGPIYSCWVKSPDRTGVNFS
SVNSNLRDLTPSHQLEVGGGFRISESKCLMQDDNRGMFMETSVCCSSEEGIASGFGRTVS
DNLMDGNCTPQNPPQKKKVSLLEYRKRQREARKSGSKAENLSLVTMSPHAPPGGSVASNG
GGGDGCSGENGEQADNMASLPLPLPAAINNASSEETGNSCPIKEASSSEKSEPEVQWTAS
TSVEQVRERSYQRALLLSDHRKDKDSDPDPENPEPTTTNECPSPDPSQKTCKSPSKLSKP
CSPGPAVPAQSLGKTPSRPDPHWETSVNAPEAESVSLAKTEPQPKQPTNNIQALCKNHPP
AHVRTSAEQLLHSQKLPSAPLKLPCPPPPPTNNPPKASTPHPPTQHGYLSPQPHSQQLGS
PYRPHHTQAPQVGTPQRDPHRSFYPAAQALASGTQPQQAAGPMFPPTSSGGQPSAPYGPF
NQPGLNGSAPPPPPPPPPSSSSTPSSASASYYQNQQQPSAPFQSYGQLKGSLPPPQTVFT
AGPNQALPGPPGPQAVPGHHVTPGHFLPTQPPGIHHQAPGPAATAPPPPPPPPPAIYGAH
QGPALFPAGAHPAVTSYPSQSQPHHPPLGPGPPHQPSGTGPHCALPVQGPHLQPPGPNSI
STPPAAGFCPHPGAGTLPHGVQGPQQASPVPGQIPIHRAQVPPTFQNNYHGSGWH
NT seq 5208 nt NT seq  +upstreamnt  +downstreamnt
atgagcatagtgatcccattgggggttgacacaacagaaacttcatatttggaaatggct
gcaggctcagaaccagaatctgtagaagctagccctgtggtagttgagaaatccaacagt
tatccacaccagttatataccagcagctcgcatcattctcacagttatattggtttgccc
tatgcggaccataactatggtgcgcgtcctcctccaacacctccagcttctcctcctcca
tcagttctcatcagcaaaaatgaagtaggcatatttactacgccaaacttcgatgagacc
tccagtgctaccacgatcagcacatctgaggacggaagctacggtactgatgtgacaagg
tgtatctgtggtttcacacacgacgatggctatatgatctgttgtgacaaatgcagtgtt
tggcaacatattgactgcatggggatcgacaggcagcacattcctgatatatatctatgt
gaacgttgtcagcctaggaatttggataaagacagggcagtactgctccaacgccggaaa
agggaaaatatgtcagatggagacaccagtgcaacagagagtggcgatgaggttcctgtg
gaattatacactgcatttcagcacacaccaacaacaattactttaactgctgcaagggtt
actaaagtcaatgataagaaaagaaagaagagtgtggaaaaggagcaaaacatttcaaaa
tgtaaaaaagctttccgtgaaggatcgaggaagtcatcaagagtcaagggttcagcacca
gagattgatccttctgatggttcaaattttggatgggaaactaaaattaaggcatggatg
gatcgttatgaagaggcaaataataaccagtacagtgagggtgtccaaagggaagcacaa
agaatagctctgaggctgggtaatggaaatgacagaaaagaaatgaacaccagatcagaa
ttgaatgccagcaatatgatcttcaagccacctgtagagagctatgtgcagaagaacaaa
aaaattctaagagctgccaaagatttgcctcctgatgcacttattattgaatacagaggg
aagttcatgctgagagaacagtttgaagccaatggatatttctttaagagaccataccct
tttgttttgttctattctaaatttcacgggctagaaatgtgtgttgacgcaaggaccttt
ggaaatgaggctcgattcatcaggcgttcatgtacaccaaatgctgaggtgaggcatgta
attgaagatggaactatacatctttatatttactccatccaaagcattctgaagggaatt
gaaattactatcgcctttgattttgactatggaaattgcaaatacaaggtggattgtgca
tgcctgaaagaaaatcctgaatgcccagttcttaaacgtggttctgagcctacagaaaac
atcaatagcggttatgagaccagaagaaaaaaaggaaagaaggagaaggatatttccaaa
gaaaaagaaacacaaaatcaaaatattactttggattgtgatggagcagccaacaaaatg
aagagtccagataataagcaacgcaaactttccccactgaggctgtccatatcaaataat
caggagccagattatattgaggagatagaagaaaaaactcctattagcaatgaagtagaa
atggaatcagaggagcagattgcagaaaggaaaaggaagctgaccagagaagaaaggaaa
atggaagctattctgcaagcttttgccaggctggaaaagagagagaaacgaagagaacag
gctttggaaagaatcagcacagcaaaaacagaagttaaacccgagtgtaaagatgcccag
attattaatgaagctgagctcgttcaggaaccagcaaaagaagaaactgccagcaaacca
acccctgccaaagtaaacagagctaaacagagaaaaagcttttctcggagcaggactcac
attggtcagcagcgccgacgacacagaactgtcagtatgtgttcagatatccagccctct
tctccagatgtggaagttacttcccaaccaaatgaaactgagaactctgcactagcagca
gaacctgataccgaacctgctgtagcagaaatcatccctgaaactgaagctccagcactt
aataaatgttctacaaaataccccaaaacaaagaagcacttggtcaatgaatggttaagt
gagaagagcgagaagcctggaaagcctacagacagcctttcagaaaggcctctacgaata
actacagaccccgaagtattggctacacaactcaattctctaccaggtctttcttacagc
ccacatgtgtattctactccaaagcactatattcgcttcacttcgccattcctttcagaa
aaaaagaggagaaaagaaccctctgaaaatgtttccggctcttgcaaaaagcgttggttg
aagcaagcattggaagaagaaaatacagcaattatagatagatttaattcaccctgtcag
gaaagatctagaagtcctacagttaatggtgaaaataaaagtccactgttacttcatgat
ggctcttccgtacaagatttaactaccccacttaaaaaacgaagactctatcaaatcctg
gatgctgcttattcagaaacctccacacctactccttctccatatgccacaccgacccat
gcagatatcactgccacagacccatccttgtttgctactcctcctagggtaaaatcagaa
gatgaaacttgtaggaatggttacaaacctatatattcaccagttacccctgtgactcct
tgtctacatggaaatgccatgcactttgagaatatttcctcaccggaaagttccccagaa
attaagaggcgagcttatagtcaagagggatatgacagaacatcaaccatgttagcattg
ggttcttttagaaattccaatttgaccgaaataagcctgcaagaaataaagactgttgga
tattccagcccaaggacaaggcctgaactcagcaggcagtgccctggagaaaaggaatct
gtatcagacctccagatgggactcgatgtaattgagcaaagtgcactgcataaaaacatg
gaaaccccctcacacgaaaggactgattcgaacagccagctagaaaccgctcactgtgga
aggggcccgatatattcttgttgggttaaaagtcctgacagaacaggtgtaaacttctct
tccgtgaattcgaacttaagagacttgacaccatcacatcagttagaggtcggaggtgga
ttccgaataagcgagtcaaagtgcctgatgcaagatgacaacagaggcatgtttatggaa
acatcagtctgctgttcttcagaagaggggatcgcatctggttttggaaggaccgttagc
gacaacttaatggatggaaactgcacaccccagaatccaccacaaaagaaaaaggtgtcc
ttactagagtatcgtaagagacagcgtgaagctaggaaaagcggctccaaggcagaaaac
ttatccctggttaccatgtcgcctcatgctcctcctgggggaagtgtggcaagcaacggc
ggcggcggggatgggtgtagtggtgaaaatggggagcaagcggataacatggctagcctg
cctttacccctcccagctgccatcaacaatgcttcatcagaagaaaccggcaacagctgt
cccattaaggaagcttcctccagtgagaagagtgaaccggaagttcagtggactgcttca
acttcagtggaacaagtgagagagagaagctatcagagagctttacttcttagtgatcac
agaaaagacaaggatagcgaccccgatccggaaaatcccgagcccacaaccacaaatgaa
tgtccgtccccagacccttctcaaaagacgtgtaaaagcccttcaaaattgagcaagcct
tgttcccccggtcccgccgttcctgcccagtcccttgggaaaacaccctccagaccggac
ccccactgggagacttcagttaacgcacccgaggccgaaagcgtcagtctggcaaaaaca
gaaccgcagccgaaacagccgaccaacaacatccaagcactttgcaaaaaccaccctccg
gcgcacgtgcgtacttcagccgagcaacttctccattcacaaaagctgccttctgcacct
ctgaagctgccctgtcctccaccaccacctacgaataaccctccaaaggcgtcgactcct
cacccccccacgcagcacggttacctgtcacctcagcctcactcccagcagctcgggtct
ccgtacaggccccaccacacccaggcccctcaagtcggaaccccccagagagaccctcac
cgcagcttctacccggcggcccaggccctggcctcgggcacccagccgcagcaggccgcc
ggacccatgttccccccgacgtcttcggggggccagccttcggccccctacggtcccttt
aaccaaccgggtttgaacggctccgccccaccccctcccccgcccccacccccttcttcc
tcctccaccccctcctccgcctcggcctcctactaccaaaaccagcagcagccctcggct
ccctttcagagttacggtcagttgaagggtagcctccccccgccccagactgtgtttaca
gccggaccaaaccaagcacttcccggcccgcccggcccacaggcggtcccggggcaccac
gtgactccggggcacttcttgccgacgcagccccccggtatccaccaccaggccccgggg
cccgctgccaccgctcccccgcccccaccgccgccgccccccgcaatatatggagcccac
caaggaccggccctcttcccggcgggcgcccaccctgccgtgacctcctacccgtcacag
tcgcagccgcaccaccccccgctgggccccggacctcctcaccagccctcgggcacagga
ccgcactgtgcattgccggtccagggccctcacctccagcccccgggaccaaacagtatt
tcaacccctccggccgcgggcttctgtccccaccctggcgccgggacgctgccgcacggg
gttcagggccctcagcaggcatcgccggtgcccggacagattcctatccacagagcacag
gtgccaccgacttttcagaacaattaccacggctcggggtggcattaa

DBGET integrated database retrieval system