KEGG   Ornithorhynchus anatinus (platypus): 100077212Help
Entry
100077212         CDS       T01045                                 

Definition
chymosin-like
Orthology
K01378  
chymosin [EC:3.4.23.4]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Brite
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.4  chymosin
     100077212
Peptidases [BR:oaa01002]
 Aspartic Peptidases
  Family A1: pepsin family
   100077212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 383 aa AA seqDB search
MYVDERDDKCFHKPMFQVLKIPLHKGLSLRQVLEKHDLLAEFLKEHGTDIGGKYRPSSLA
GGQVGSEPLANFLETEYFGTISIGTPPQEFTVVFDTGSSDFWVPSVFCNSHACKTHRRYD
PSLSSTFQDTGKDLSIYYSDGRMQGLSWLSPVQISDLVSTHQAFGLSTQELGGIFTHATF
DGVLGLAYPSLSSSEATPVFDHMMKESLVAQGLFSIYLSRRSNESLITFGAIDEFHYTGP
IHWVPVTQAMYWQIAVDKITVDGEVVACGGGCQAILDTGTSLMAGPSPDIAGIQYLIGAT
EGRNGLYQVDCRKLQRLPDVVFHISGVKYPLTATAYTNKNGGICYSGFEGESGGQWILGV
VFIREYYSIFDRAHQRVGLAKAV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtggatgagagagatgataaatgtttccataaaccaatgttccaggtgctgaag
atccccctgcacaaggggctgtcactgaggcaagtcctggagaagcatgaccttttggca
gagtttctgaaggagcacgggactgacatcggcggcaaataccgtccttcctcccttgct
ggtgggcaagtaggctcggagccgctggctaattttctcgagacagagtacttcggcacc
atctccattgggactccaccccaggaattcactgtggtgtttgacaccggctcctctgac
ttctgggtaccttccgtcttctgcaatagtcacgcctgcaaaacccacaggaggtatgat
ccctccctctcgtccactttccaagacactggaaaagacctgtctatctactacagtgac
gggagaatgcaggggctttcctggctgtctcccgtacagatctccgacctggtctccacc
caccaggcctttggtctgagcacccaagagctgggtggcatcttcacccatgccacgttt
gatggcgtcctgggcctggcctacccctctctgtcatcctccgaggccacgccggtcttt
gaccacatgatgaaagaaagcctcgtcgcccaaggtctgttctccatctacctgagcaga
cgcagcaacgagagcctgatcaccttcggggccatcgatgaattccactacaccggccct
atccactgggtgcctgtcacccaggcgatgtactggcagattgctgtggacaaaatcacc
gtggatggggaggtggtggcctgcggagggggctgccaagccatcctggacactggcacc
tccctgatggctggccccagtccagacattgcgggcatccagtacctgatcggggccacg
gagggcaggaatggactgtaccaggtggactgcagaaagctgcaacgattgcctgatgtc
gtctttcatatcagcggcgtcaagtatccgctgaccgccaccgcctacaccaacaagaac
ggcggcatctgttacagcggcttcgagggcgagtccgggggccagtggatcctgggagtt
gtcttcattagggaatattacagcatctttgaccgagcccaccagcgtgtggggttggcc
aaagctgtctaa

DBGET integrated database retrieval system