KEGG   Ornithorhynchus anatinus (platypus): 100077248Help
Entry
100077248         CDS       T01045                                 

Definition
inositol monophosphatase 3-like
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:oaa00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:oaa00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:oaa04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 365 aa AA seqDB search
MTFCNDGRPLGAMLGPTDPVPTLGPCRAGLRPPRPVLRGPAGGGRVELRQLLAPSVATAE
AGGREVWAVRQEVGELWRQTKGGNREGPEDFLTAGDPQSHRRMTGMWAHAFPAIRSGDRD
SSELRNSEIPADIQERISHLRTVPVDRRTVWIDPLDATQEYTEGLLSYVTTTVWVAVDGK
PVIIGVIHKPFSGFTGWALVGEGANVSRREVYRGKSPRLIVSRTQAGAVCTFSQGAFGSS
VSTVPARGAAHVTGEQCRALTDLVGEPPASRTDSHGPPVSPGYKVLSLLEFDKAEQPDQA
DAYVHVTFIKERYARAGHAVHMTTLSGQDIDYRDSPVNKEGLIANVGLDHRHLVRKIRGL
VEQRD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgactttctgtaacgatggccggcctcttggggccatgcttggcccgaccgaccccgtt
cccactcttggcccttgccgtgctgggctgcggcctcctcgtccagttctccgtggtcca
gccggcgggggccgggtggaactgcggcagctgctggccccgtcggtggcgacggccgag
gcgggcggccgggaggtgtgggcggtcaggcaggaggtgggcgagctgtggcggcagacc
aagggcgggaaccgggagggccctgaggactttctgacggccggggacccgcagtcccac
cgccgcatgaccggcatgtgggcccacgcctttcccgccatccgcagtggggacagggat
tcctctgagctgcggaacagtgagatcccggctgacatccaggagagaatctcccacctc
aggacggtgcctgtggacagaaggactgtctggatcgaccccctggatgccacgcaggag
tacacagagggtctcctgtcctacgtgaccacgacggtgtgggtggctgtggatgggaag
ccggtcatcatcggagtcattcacaaacccttctcagggttcacagggtgggccctggtc
ggggaaggagccaatgtgagccggagggaggtgtacagagggaagagcccgcgtctcatc
gtgtcccgcactcaggccggggccgtctgcaccttcagccagggggcctttggaagcagt
gtgagcactgtgcccgccaggggagcagcgcatgtgactggggagcaatgtcgggccctg
acggacctggtgggggagcctccggccagcaggacggactcacacggacctcctgtgtcc
ccagggtacaaagtgctctccctcctggaattcgacaaggccgagcagccggaccaggcg
gacgcgtacgtccacgtcaccttcatcaaggagcggtacgcccgagcgggccacgcggtg
cacatgaccactctgtctggccaggacatcgactatcgggactcgccagtcaacaaggag
gggctgatcgccaacgtgggcctggatcaccgccacctcgtgaggaagatcaggggcctg
gtggagcagcgggattga

DBGET integrated database retrieval system