KEGG   Ornithorhynchus anatinus (platypus): 100077343Help
Entry
100077343         CDS       T01045                                 

Gene name
ITGA8
Definition
integrin, alpha 8
Orthology
K06584  
integrin alpha 8
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100077343 (ITGA8)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100077343 (ITGA8)
   04514 Cell adhesion molecules (CAMs)
    100077343 (ITGA8)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100077343 (ITGA8)
  Cellular commiunity
   04510 Focal adhesion
    100077343 (ITGA8)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100077343 (ITGA8)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100077343 (ITGA8)
   05414 Dilated cardiomyopathy (DCM)
    100077343 (ITGA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 954 aa AA seqDB search
MPVDDNRKIKVNGSKEPIEFKSNQWFGATVKAHEGKVVACAPLYHWRTLKATSEKDPVGT
CYVAIQNFSTYAEYSPCRNSNPDPEGQGYCQAGFSVDFYKNGDLILGGPGSFYWQGQVIT
TSVADIVAGYSFKNILRKLSGEKQTDVAPASYDDSYLGYSVAAGEFTGDSDQELVAGIPR
GAQNFGSVSIINSTDLTFIQNFTGEQMASYFGYTVAVSDVNSDGLDDVLVGAPLFMEREM
ESDPREVGRVYLFLQEGVLAFRDAQVLTGTEPFGRFGSAISHLGDLDQDGYNDIAVGAPF
AGEGGRGRVFIYNGHRDGVSVRPSQILEGAWTSETTPSGFGFTLRGGSDIDHNRYPDLIV
GAFGAGKVVVYRARPVVTVSAQLLLQPRIINPENQSCQLPGSGTPVACLTVKVCGSVAGR
SLPDFVALRAEVQLDALKLQGAVRRILFFESHQSQLIFSLMVPSGQKSPRCQDFTVYLRD
ETEFRDKLSPIHISLNYSLDESSPAEGLAVKPILNYYRPTVVKEQAHILVECGEDNVCIP
DLKLSARPDRSQLVIGDENHLTLIINPRNRGEGAYEAELHVLIPEEADYIGIERNNKALH
ILSCEYKMENESRMVACDLGNPMAAGTNISLGLRFAVQRLENANFSINFDLHIRSSNQDH
PQSNFVSLQINISAAAEVELRGVSHPPQVVLPVPEWEPVEDPQEEEDVGPLVEHVYELYN
VGPSAVSSTVLEVGWPISNRDEFLLYVFSLQTLGPVQCQANPAINSKQIKPAFPRADTPE
LSAFLRNSTIPHHVSRRDTEGPPLHRQTPARILNCTNVGCLYISCTIGRLEGGESAVLKV
RSRLWAETFLQRKNDPYSLMAMVSFGVKKMPYKVRPAELAKGRISVRTTVVWATPNVSFA
IPLWVIILAILLGLLVLALLTVALWKCGFFDRARPPQDDMADREQLTHNKTTDA
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcgatgataaccgcaagattaaggttaacgggagcaaggagcccatagagttc
aaatccaatcagtggttcggggctaccgtgaaagctcacgagggaaaagtggtggcctgc
gcccccctgtaccattggcggacgctgaaagccaccagtgagaaggaccccgtgggcacc
tgctacgtggcgatccagaacttcagtacctacgccgagtactccccctgccgcaacagc
aaccccgatcccgaaggccaaggttactgccaagccggtttcagcgtggatttctacaag
aatggagatctgattctcggcggcccgggaagtttttactggcaaggtcaggtgatcacc
accagcgttgctgacatcgtcgcgggttactccttcaagaacatcctccggaaactgagc
ggagaaaagcaaaccgacgtggcgcccgcatcctatgacgacagctacctgggttactcg
gtcgctgcaggagaatttactggagattcagaccaagaactggtcgctggcataccacga
ggagctcagaacttcggttcggtttcgattattaattctacagacttgaccttcattcag
aactttaccggtgaacagatggcatcttattttgggtacacggttgcagtgtctgacgtc
aacagtgatggtttggatgacgtcctggtgggagcccccctctttatggagcgagagatg
gagagcgaccccagagaggtgggacgagtgtatctcttcttgcaggagggcgtgctcgcc
tttagagacgcccaagtgctcactggcacggagccgtttggacgattcggtagcgccatc
agccacttgggagacctggatcaggatggatacaatgatattgccgtcggcgcccccttt
gccggggagggcggacggggccgcgtgttcatctacaacgggcaccgggacggggtcagc
gtccgtccgtcccagattctggagggagcgtggacctcagagaccaccccctcgggcttc
ggcttcaccttgagaggaggttcggacatagaccacaaccggtacccagatctaatcgtg
ggagcgtttggggctggaaaagtggtggtttacagagccaggcctgtggtgacggtgagt
gcccagctcctgcttcagccaagaatcattaaccccgaaaaccagagctgccagctcccg
ggctcggggacccccgtggcttgcctgactgtaaaagtctgtgggtccgtagcaggccga
agtcttccagattttgtcgctctgcgggctgaagtccagctagacgccttgaagctgcaa
ggagctgtgagaagaatcctcttctttgaatcccatcaatctcagcttatcttctctctg
atggtccccagtggacagaaatccccccggtgtcaggacttcactgtttacctaagggat
gaaacggagttccgagataaattgtctccgatccacatcagcctcaactacagtttggac
gagtcctcgcccgcggaaggcctcgcggtgaaaccgattctgaactactaccggccgacg
gtggtgaaggaacaggctcacatcctggtggagtgtggagaggacaacgtgtgcattcct
gatttgaaactttcggcccgaccggacaggtcccagttggtcatcggagacgaaaaccac
ctgacgctcatcatcaacccaaggaaccggggggaaggggcttacgaggctgagctccac
gtgctgatccctgaggaggcggattatattggaattgagcggaacaacaaggccctgcac
atcctcagctgcgaatacaagatggaaaacgaatcaagaatggtggcgtgcgacctcggg
aaccccatggcggccggaaccaacatctccctgggtctccgatttgctgtccagcgactg
gaaaatgcaaatttcagcatcaactttgacttacacatcagaagctccaaccaagatcac
ccacagagcaatttcgtgagtctgcaaatcaacatcagtgcagctgccgaagtggagcta
agaggtgtgtcccacccaccccaagttgttcttcctgttccggaatgggagcccgtagag
gatccccaggaggaagaggacgtcggtccactggttgagcacgtatatgagctgtacaac
gtcggtccaagtgccgtgagcagtaccgtcctggaggtgggctggccgatctctaaccga
gacgagtttctcctctacgttttctctctccagaccctcggccctgtgcagtgccaagca
aaccccgcaatcaactcgaagcagataaagcctgcattcccccgggcggacacccccgag
ctcagtgcctttctgcggaactccactatccctcaccacgtcagcaggagggacacggag
ggacccccgcttcaccggcaaaccccggcaagaatactgaactgcacaaacgttgggtgc
ttgtacatctcctgtacgatcggacgtctggaaggcggagaaagcgcggtcctgaaagtc
agatcaagactctgggcggaaacgttcctccagagaaaaaacgatccctactcccttatg
gccatggtatccttcggagtgaagaagatgccctacaaggtccggccggcagaactcgcc
aaggggagaatttcggtgcgaacgacggtcgtctgggccacaccaaacgtctcctttgca
atcccactgtgggttataatattggccatcctcttagggctgctcgttctggccttgttg
accgtagcactgtggaagtgcggcttcttcgacagggccaggccccctcaggacgatatg
gcggacagagagcagctgacacacaacaagactactgatgcgtga

DBGET integrated database retrieval system