KEGG   Ornithorhynchus anatinus (platypus): 100077350Help
Entry
100077350         CDS       T01045                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:oaa00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:oaa03320]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:oaa05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 823 aa AA seqDB search
MKGKALRLVVLGAWLLGLAATRGAAASDTLPCALSPPLHPQPFLAPPDLCAQQPFCAPPV
LPCAPQPSPAPPVLPCSPSPHLYPQPFCAPTLPCAPSPAMCPQPFCRPLLSPVPSALSYT
PSPFPRPQTCAPPTLSCALALLPVRPQPSPTPRDLPCAPSSAVCPQPFCASPALRSSSSP
ARGDRASISSPWESRGIEAEPGPPARPAARPPRGLSAGSGRPVWEPPRSSAKPRPLALLP
PAIPRKRRDGKISRSGLESQSPGCRSKGNSGVDPAPNLHPGIGKLEHLNKEPKSRQQQVT
TEDNRCPVSRCLSRLLGDRGWDIIPPGPLADMHPPEIVHNWKVINQLPYKVGAHHHELMS
VFELKHAICGDSRTNFEDIESRFSLRTPEVPDDDTCYLVPGDRDSVAECHFNHTSKTFVV
IHGWTVTGMYESWVPKLVDALYKREPDSNVIVVDWLIRAQQHYPVSAGYTKLVGGDVARF
IDWMEEQFNYPLDNVHILGYSLGAHAAGIAGSRTNKKVNRITGLDPAGPTFEYAEAPSRL
SPDDADFVDVLHTFTRGSPDRSIGIQKPVGHVDIYPNGGGFQPGCNIGEAIRLIAEKGFG
DVDQLVKCSHERSIHLFIDSLLNEEKPIMAYRCNSKEAFEKGLCLNCRKNRCNNLGYEVN
KVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFLGTESITQTNQPFLISLYGTVDESENIPF
VLPEISTNKTYSFLVYTEVDIGELLMLKLQWEKDSIFSWSGWWSSAAFDIEKVRVKAGET
QKKVVFCSRDKVSALKKGKAPMIFVKCHDKSLKSPKFLKKKTV
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcaaagctctgcggttggtggtgctgggcgcctggctactgggcctggcggcg
acccggggagcagccgcttcggacaccctcccctgcgccctcagccctcccttgcacccc
cagccctttcttgctcccccagacctgtgcgcccaacagcccttctgtgcgcccccagtc
ctgccatgtgccccccagccctcccctgcgcccccagtcctgccatgttcccccagccct
cacctgtacccccagcccttctgtgccccaaccctcccttgcgcccctagtcctgccatg
tgcccccagcccttctgtcgtcccctgctctcccctgtgccctcagctctctcttacacc
cccagccctttcccgcgcccccagacctgtgcgcccccaaccctctcctgcgccctagcc
cttctacctgtgcgcccccagccctctcctacaccccgagacctgccatgcgcccccagc
tctgccgtgtgcccccagcccttctgtgcgtccccagctctccggtcctcctccagcccc
gcccgtggagaccgagcctccatttcttccccttgggagagcagagggatcgaggccgag
cccgggccaccggcccgcccagcagctcgcccgccacgtggactttcggccggctcgggg
aggccagtttgggagccccctaggagctcggcgaagccgcggcccctcgccctgctccct
cccgccattcctagaaagcgtcgagatggcaagataagcaggtcggggctggaaagccag
tcccctggctgccgctccaaggggaattctggagttgacccagctccgaatctgcacccc
gggattgggaaactggagcacttgaacaaagagccaaaaagccggcagcagcaggtaacg
acggaggacaatcgttgccctgtcagtcgctgtctgtcccgcctgctgggagatagaggc
tgggacatcattcctcccggccccttggcagatatgcatcctcctgaaattgttcataat
tggaaagtgataaatcaacttccgtataaagttggagcccatcatcatgagctaatgagc
gtttttgagctaaaacatgcaatatgtggggacagcagaaccaattttgaagatattgaa
agcaggttttctctgaggactcccgaggtacctgatgatgacacctgttaccttgtccct
ggcgacagagattctgttgcggagtgccatttcaaccacaccagtaaaacctttgtggtg
atccatggatggacggtgacaggaatgtatgagagctgggtgccaaagcttgtggatgcg
ctatataagagggaaccagattccaatgtcattgtggtagactggcttatacgtgcccaa
caacactatccagtatctgctggctacactaaactggtaggaggagatgtagccaggttt
atcgactggatggaggagcaatttaactaccccctggacaatgttcatatcttggggtat
agccttggtgcccatgcggctggcattgcaggaagtcggactaacaaaaaagtgaacaga
atcaccggcctagatcccgctggacctacctttgaatatgctgaagctccaagccgcctc
tctcctgatgatgccgattttgtagatgtactgcacacctttactagaggctccccagac
cgcagtatcggaatccagaagcccgtgggacacgttgacatttaccccaatggtggaggt
ttccagccaggatgtaacataggagaagcgattcgcttgattgcagaaaagggctttgga
gatgtggaccagctggtgaaatgctctcatgaacgttccattcatctcttcattgactcc
ctgttgaatgaagaaaagccaatcatggcctatcgttgcaactccaaggaagcttttgaa
aaggggctttgtctgaactgccggaagaatcgctgcaacaatctgggctatgaggtcaat
aaagtgagagccaagagaagcagcaaaatgtacctgaaaacccgctctcagatgccctac
aaagttttccattatcaagtcaagatacatttccttgggactgaaagtattactcagacc
aatcaaccattcctgatctccttgtatggcacagttgatgagagtgagaacattcctttt
gtcctgcctgaaatttccaccaacaagacctattccttcctcgtttacactgaggtagat
attggagagctgcttatgttgaagctgcagtgggaaaaggattcaatcttcagctggtct
ggctggtggagcagtgctgcctttgatatcgagaaagtcagagtgaaagctggagaaaca
cagaaaaaggtagttttctgctctcgagacaaagtctcagcactgaagaaagggaaagcg
ccaatgatttttgtaaaatgccatgacaagtcccttaagtcccctaagttcctaaagaag
aagactgtctga

DBGET integrated database retrieval system