KEGG   Ornithorhynchus anatinus (platypus): 100077350Help
Entry
100077350         CDS       T01045                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Cholesterol metabolism
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100077350 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100077350 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    100077350 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100077350 (LPL)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     100077350 (LPL)
Exosome [BR:oaa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100077350 (LPL)
  Exosomal proteins of breast milk
   100077350 (LPL)
Glycosaminoglycan binding proteins [BR:oaa00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   100077350 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:oaa00537]
 Enzymes
  100077350 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
5
AA seq 482 aa AA seqDB search
MKGKALRLVVLGAWLLGLAATRGAAASDRDSRTNFEDIESRFSLRTPEVPDDDTCYLVPG
DRDSVAECHFNHTSKTFVVIHGWTVTGMYESWVPKLVDALYKREPDSNVIVVDWLIRAQQ
HYPVSAGYTKLVGGDVARFIDWMEEQFNYPLDNVHILGYSLGAHAAGIAGSRTNKKVNRI
TGLDPAGPTFEYAEAPSRLSPDDADFVDVLHTFTRGSPDRSIGIQKPVGHVDIYPNGGGF
QPGCNIGEAIRLIAEKGFGDVDQLVKCSHERSIHLFIDSLLNEEKPIMAYRCNSKEAFEK
GLCLNCRKNRCNNLGYEVNKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFLGTESITQTN
QPFLISLYGTVDESENIPFVLPEISTNKTYSFLVYTEVDIGELLMLKLQWEKDSIFSWSG
WWSSAAFDIEKVRVKAGETQKKVVFCSRDKVSALKKGKAPMIFVKCHDKSLKSPKFLKKK
TV
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcaaagctctgcggttggtggtgctgggcgcctggctactgggcctggcggcg
acccggggagcagccgcttcggacagggacagcagaaccaattttgaagatattgaaagc
aggttttctctgaggactcccgaggtacctgatgatgacacctgttaccttgtccctggc
gacagagattctgttgcggagtgccatttcaaccacaccagtaaaacctttgtggtgatc
catggatggacggtgacaggaatgtatgagagctgggtgccaaagcttgtggatgcgcta
tataagagggaaccagattccaatgtcattgtggtagactggcttatacgtgcccaacaa
cactatccagtatctgctggctacactaaactggtaggaggagatgtagccaggtttatc
gactggatggaggagcaatttaactaccccctggacaatgttcatatcttggggtatagc
cttggtgcccatgcggctggcattgcaggaagtcggactaacaaaaaagtgaacagaatc
accggcctagatcccgctggacctacctttgaatatgctgaagctccaagccgcctctct
cctgatgatgccgattttgtagatgtactgcacacctttactagaggctccccagaccgc
agtatcggaatccagaagcccgtgggacacgttgacatttaccccaatggtggaggtttc
cagccaggatgtaacataggagaagcgattcgcttgattgcagaaaagggctttggagat
gtggaccagctggtgaaatgctctcatgaacgttccattcatctcttcattgactccctg
ttgaatgaagaaaagccaatcatggcctatcgttgcaactccaaggaagcttttgaaaag
gggctttgtctgaactgccggaagaatcgctgcaacaatctgggctatgaggtcaataaa
gtgagagccaagagaagcagcaaaatgtacctgaaaacccgctctcagatgccctacaaa
gttttccattatcaagtcaagatacatttccttgggactgaaagtattactcagaccaat
caaccattcctgatctccttgtatggcacagttgatgagagtgagaacattccttttgtc
ctgcctgaaatttccaccaacaagacctattccttcctcgtttacactgaggtagatatt
ggagagctgcttatgttgaagctgcagtgggaaaaggattcaatcttcagctggtctggc
tggtggagcagtgctgcctttgatatcgagaaagtcagagtgaaagctggagaaacacag
aaaaaggtagttttctgctctcgagacaaagtctcagcactgaagaaagggaaagcgcca
atgatttttgtaaaatgccatgacaagtcccttaagtcccctaagttcctaaagaagaag
actgtctga

DBGET integrated database retrieval system