KEGG   Ornithorhynchus anatinus (platypus): 100077443Help
Entry
100077443         CDS       T01045                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Toxoplasmosis
Tuberculosis
Hepatitis B
Influenza A
Herpes simplex infection
Pathways in cancer
Colorectal cancer
Small cell lung cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100077443
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100077443
   04115 p53 signaling pathway
    100077443
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100077443
   05210 Colorectal cancer
    100077443
   05222 Small cell lung cancer
    100077443
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100077443
   05012 Parkinson's disease
    100077443
   05014 Amyotrophic lateral sclerosis (ALS)
    100077443
   05016 Huntington's disease
    100077443
  Cardiovascular diseases
   05416 Viral myocarditis
    100077443
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100077443
  Infectious diseases
   05134 Legionellosis
    100077443
   05152 Tuberculosis
    100077443
   05164 Influenza A
    100077443
   05161 Hepatitis B
    100077443
   05168 Herpes simplex infection
    100077443
   05145 Toxoplasmosis
    100077443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 105 aa AA seqDB search
MGDFEKGKKIFVQKCAQCHTVEKGGKHKTGPNLNGLFGRKTGQAPGFSYTDANKSKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKKGERADLVAYLKKATKE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacttcgagaagggcaagaagatctttgtgcagaaatgcgcccagtgccacaca
gtcgaaaagggaggcaagcacaagaccggacccaacctgaacggactgtttggacggaag
actgggcaggctccaggttttagttatacagatgccaacaagagcaaaggcatcacctgg
ggagaggaaacactgatggaatacttggaaaatcccaagaagtatatccctggcacaaaa
atgatcttcgccggcattaagaagaagggcgaaagggcagacttggtagcatatctcaaa
aaagccaccaaggagtaa

DBGET integrated database retrieval system